StarFunc result for job id Q8N3C0

User Input

>input (2202 residues)
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEK
SKMQSINEDLKDILHAAKQIVGTDNGREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG
PFPSSSATAACNATNRIISHFSQDDLTALVQMTEKEHGDRVFFGKNLAFSFDMHDLDHFD
ELPINGETQKTISLDYKKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTE
VPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRITIVDRFLNSSND
HRFQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDLEV
SEGLMCFDPKELRIQREQALLNARSVPILSRQRDADVEKIHYPHVYDSQAEAMKTSAFIA
GAKMILPEGIQRENNKLYEEVRIPYSEPMPLSFEEKPVYIQDLDEIGQLAFKGMKRLNRI
QSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMK
ALAAEMTDYFSRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVA
LSQIVRLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATF
LHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLKQVKAGHQVMV
FVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFS
IHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVD
LGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNA
EIALGTVTNVEEAVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRK
LDKAQMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDIFAIVSKAEE
FDQIKVREEEIEELDTLLSNFCELSTPGGVENSYGKINILLQTYISRGEMDSFSLISDSA
YVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSILPPHILTR
LEEKKLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVMMEASIQPITRTVLRVTL
SIYADFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVISKEAQLLVFTIPIF
EPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYEA
LYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAP
LKALVRERMDDWKVRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQN
RNYVQQVTILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLA
DWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLI
FVSSRRQTRLTALELIAFLATEEDPKQWLNMDEREMENIIATVRDSNLKLTLAFGIGMHH
AGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPI
TDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIA
GGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSHDSVNKFLSHLIEKSLIELELSYC
IEIGEDNRSIEPLTYGRIASYYYLKHQTVKMFKDRLKPECSTEELLSILSDAEEYTDLPV
RHNEDHMNSELAKCLPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQA
LRVCQAMLDVAANQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKP
IMKGPHARGRTSIESLPELIHACGGKDHVFSSMVESELHAAKTKQAWNFLSHLPVINVGI
SVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQEYVLQVSLQRVHFGFHKGKPES
CAVTPRFPKSKDEGWFLILGEVDKRELIALKRVGYIRNHHVASLSFYTPEIPGRYIYTLY
FMSDCYLGLDQQYDIYLNVTQASLSAQVNTKVSDSLTDLALK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3jcmN	0.681	0.874	0.000	1686	0.282	0.368	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
2	PDB:5dcaA	0.779	0.876	0.000	1948	0.308	0.349	5dcaA.pdb.gz
3	PDB:6qw65B	0.761	0.836	0.000	2001	0.375	0.413	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
4	AFDB:O48534	0.825	0.836	0.000	2172	0.374	0.379	O48534.pdb.gz	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
5	AFDB:O60072	0.788	0.893	0.000	1935	0.407	0.463	O60072.pdb.gz	SLH1_SCHPO RQC trigger complex helicase slh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slh1 PE=1 SV=1
6	AFDB:O75643	0.814	0.838	0.000	2136	0.380	0.392	O75643.pdb.gz	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
7	AFDB:P32639	0.802	0.816	0.000	2163	0.312	0.318	P32639.pdb.gz	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
8	AFDB:P53327	0.781	0.872	0.000	1967	0.384	0.430	P53327.pdb.gz	SLH1_YEAST RQC trigger complex helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLH1 PE=1 SV=2
9	AFDB:Q582D6	0.748	0.737	0.000	2237	0.256	0.252	Q582D6.pdb.gz	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
10	AFDB:Q8N3C0	1.000	1.000	0.000	2202	1.000	1.000	Q8N3C0.pdb.gz	ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3
11	AFDB:Q9FNQ1	0.845	0.862	0.000	2157	0.466	0.476	Q9FNQ1.pdb.gz	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
12	AFDB:Q9SYP1	0.817	0.829	0.000	2171	0.387	0.392	Q9SYP1.pdb.gz	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
13	AFDB:Q9UT24	0.815	0.824	0.000	2176	0.336	0.340	Q9UT24.pdb.gz	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
14	PDB:6d6qM	0.218	0.614	4.596E-20	709	0.063	0.195	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
15	PDB:2xgjB	0.196	0.509	5.918E-20	777	0.065	0.185	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
16	PDB:6ro1A	0.194	0.435	2.697E-19	919	0.067	0.161	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
17	PDB:6iegA	0.193	0.442	2.038E-18	872	0.064	0.163	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
18	PDB:4xgtA	0.202	0.426	2.449E-17	961	0.068	0.156	4xgtA.pdb.gz
19	PDB:7z4yB	0.166	0.370	6.187E-17	930	0.059	0.140	7z4yB.pdb.gz
20	PDB:7qdyA	0.169	0.303	3.200E-16	1169	0.074	0.140	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1A5	0.0	949	1375	0.208	0.333	A0A494C1A5_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase (Fragment) OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=1
2	O48534	0.0	1473	2172	0.357	0.362	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
3	O60072	0.0	1677	1935	0.404	0.460	SLH1_SCHPO RQC trigger complex helicase slh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slh1 PE=1 SV=1
4	O75643	0.0	1573	2136	0.357	0.368	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
5	P32639	0.0	1069	2163	0.310	0.315	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
6	P53327	0.0	1525	1967	0.354	0.397	SLH1_YEAST RQC trigger complex helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLH1 PE=1 SV=2
7	Q582D6	0.0	709	2237	0.223	0.220	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
8	Q8N3C0	0.0	4588	2202	1.000	1.000	ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3
9	Q961L2	0.0	994	774	0.209	0.594	Q961L2_DROME GH18520p OS=Drosophila melanogaster OX=7227 GN=obe PE=2 SV=1
10	Q9FNQ1	0.0	1961	2157	0.452	0.461	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
11	Q9SYP1	0.0	1528	2171	0.365	0.370	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
12	Q9UT24	0.0	1269	2176	0.311	0.315	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
13	Q9VF56	0.0	2159	2183	0.485	0.490	Q9VF56_DROME Obelus OS=Drosophila melanogaster OX=7227 GN=obe PE=1 SV=2
14	Q9VUV9	0.0	1469	2142	0.347	0.356	U520_DROME U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=Brr2 PE=2 SV=4
15	D3Z4R1	3.36e-101	361	1434	0.110	0.169	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
16	B6DMK2	3.34e-87	315	1205	0.088	0.160	MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=MER3 PE=2 SV=1
17	Q5D892	3.19e-85	308	1133	0.087	0.169	MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana OX=3702 GN=MER3 PE=2 SV=1
18	Q381X2	1.46e-76	284	1408	0.108	0.169	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
19	P51979	1.97e-74	275	1187	0.091	0.169	HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFM1 PE=1 SV=3
20	Q8CGS6	2.64e-28	128	2544	0.051	0.044	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	0.94	21.1	AAA domain
2	PF13401 AAA_22	0.0079	27.9	AAA domain
3	PF12775 AAA_7	24	15.9	P-loop containing dynein motor region
4	PF00270 DEAD	1.8e-49	179.4	DEAD/DEAH box helicase
5	PF02844 GARS_N	82	15.4	Phosphoribosylglycinamide synthetase, N domain
6	PF00271 Helicase_C	1.4e-13	62.5	Helicase conserved C-terminal domain
7	PF18149 Helicase_PWI	0.24	23.0	N-terminal helicase PWI domain
8	PF01695 IstB_IS21	1.3e+02	13.5	IstB-like ATP binding protein
9	PF02562 PhoH	1.1	20.2	PhoH-like protein
10	PF04851 ResIII	5.6e-23	93.3	Type III restriction enzyme, res subunit
11	PF02889 Sec63	2.2e-147	500.7	Sec63 Brl domain
12	PF00437 T2SSE	1.2	19.7	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380877	0.999	Activating signal cointegrator 1 complex subunit 2
2	9606.ENSP00000302232	0.998	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
3	9606.ENSP00000261884	0.993	Activating signal cointegrator 1
4	9606.ENSP00000339404	0.991	Activating signal cointegrator 1 complex subunit 1
5	9606.ENSP00000411409	0.885	E3 ubiquitin-protein ligase ZNF598
6	9606.ENSP00000460348	0.837	Pre-mRNA-processing-splicing factor 8
7	9606.ENSP00000298310	0.785	Nuclear export mediator factor NEMF
8	9606.ENSP00000321617	0.722	Ankyrin repeat and zinc finger domain-containing protein 1
9	9606.ENSP00000360532	0.717	Cell division cycle 5-like protein
10	9606.ENSP00000253686	0.712	Mitochondrial ribosomal protein S25
11	9606.ENSP00000331901	0.700	Elongation factor 1-gamma
12	9606.ENSP00000365071	0.699	G-patch domain and ankyrin repeats 1
13	9606.ENSP00000272433	0.693	Sideroflexin-5
14	9606.ENSP00000417963	0.690	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
15	9606.ENSP00000232607	0.689	Uridine 5'-monophosphate synthase
16	9606.ENSP00000361926	0.676	Protein canopy homolog 3
17	9606.ENSP00000230053	0.674	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
18	9606.ENSP00000266079	0.674	Pre-mRNA-processing factor 6
19	9606.ENSP00000359799	0.670	DnaJ homolog subfamily B member 4
20	9606.ENSP00000360939	0.666	UMP-CMP kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004386	1.000	helicase activity
GO:0003723	1.000	RNA binding
GO:0140097	0.998	catalytic activity, acting on DNA
GO:0043138	0.990	3'-5' DNA helicase activity
GO:0003729	0.379	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0034641	0.990	cellular nitrogen compound metabolic process
GO:0006725	0.987	cellular aromatic compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:1901360	0.958	organic cyclic compound metabolic process
GO:0046483	0.958	heterocycle metabolic process
GO:0010467	0.957	gene expression
GO:0090304	0.949	nucleic acid metabolic process
GO:0044260	0.943	cellular macromolecule metabolic process
GO:0016043	0.870	cellular component organization
GO:0050896	0.603	response to stimulus
GO:0050789	0.537	regulation of biological process
GO:1901564	0.532	organonitrogen compound metabolic process
GO:0050794	0.502	regulation of cellular process
GO:0051716	0.478	cellular response to stimulus
GO:0006974	0.425	cellular response to DNA damage stimulus
GO:0044265	0.405	cellular macromolecule catabolic process
GO:0044271	0.380	cellular nitrogen compound biosynthetic process
GO:0010498	0.372	proteasomal protein catabolic process
GO:0006259	0.366	DNA metabolic process
GO:1901566	0.352	organonitrogen compound biosynthetic process
GO:0019222	0.342	regulation of metabolic process
GO:0009059	0.325	macromolecule biosynthetic process
GO:0060255	0.315	regulation of macromolecule metabolic process
GO:0080090	0.313	regulation of primary metabolic process
GO:0051171	0.306	regulation of nitrogen compound metabolic process
GO:0006281	0.304	DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0005654	0.995	nucleoplasm
GO:0005829	0.984	cytosol
GO:0016020	0.957	membrane
GO:1902494	0.707	catalytic complex
GO:1990904	0.532	ribonucleoprotein complex
GO:0005667	0.451	transcription regulator complex
GO:0090575	0.390	RNA polymerase II transcription regulator complex
GO:1990391	0.307	DNA repair complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.4	0.990	DNA 3'-5' helicase.

[back to server]