StarFunc result for job id Q8N3D4

User Input

>input (1523 residues)
MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWTRRNRRICSKAHSWQP
GIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYEAKEWTFIIENESKGQRKVLATAEVDL
ARHAGPVPVQVPVRLRLKPKSVKVVQAELSLTLSGVLLREGRATDDDMQSLASLMSVKPS
DVGNLDDFAESDEDEAHGPGAPEARARVPQPDPSRELKTLCEEEEEGQGRPQQAVASPSN
AEDTSPAPVSAPAPPARTSRGQGSERANEAGGQVGPEAPRPPETSPEMRSSRQPAQDTAP
TPAPRLRKGSDALRPPVPQGEDEVPKASGAPPAGLGSARETQAQACPQEGTEAHGARLGP
SIEDKGSGDPFGRQRLKAEEMDTEDRPEASGVDTEPRSGGREANTKRSGVRAGEAEESSA
VCQVDAEQRSKVRHVDTKGPEATGVMPEARCRGTPEAPPRGSQGRLGVRTRDEAPSGLSL
PPAEPAGHSGQLGDLEGARAAAGQEREGAEVRGGAPGIEGTGLEQGPSVGAISTRPQVSS
WQGALLSTAQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQEKEVEGSGFPETRTL
EIEILGALEKEAARSRVLESEVAGTAQCEGLETQETEVGVIETPGTETEVLGTQKTEAGG
SGVLQTRTTIAETEVLVTQEISGDLGPLKIEDTIQSEMLGTQETEVEASRVPESEAEGTE
AKILGTQEITARDSGVREIEAEIAESDILVAQEIEVGLLGVLGIETGAAEGAILGTQEIA
SRDSGVPGLEADTTGIQVKEVGGSEVPEIATGTAETEILGTQEIASRSSGVPGLESEVAG
AQETEVGGSGISGPEAGMAEARVLMTRKTEIIVPEAEKEEAQTSGVQEAETRVGSALKYE
ALRAPVTQPRVLGSQEAKAEISGVQGSETQVLRVQEAEAGVWGMSEGKSGAWGAQEAEMK
VLESPENKSGTFKAQEAEAGVLGNEKGKEAEGSLTEASLPEAQVASGAGAGAPRASSPEK
AEEDRRLPGSQAPPALVSSSQSLLEWCQEVTTGYRGVRITNFTTSWRNGLAFCAILHRFY
PDKIDYASLDPLNIKQNNKQAFDGFAALGVSRLLEPADMVLLSVPDKLIVMTYLCQIRAF
CTGQELQLVQLEGGGGAGTYRVGSAQPSPPDDLDAGGLAQRLRGHGAEGPQEPKEAADRA
DGAAPGVASRNAVAGRASKDGGAEAPRESRPAEVPAEGLVNGAGAPGGGGVRLRRPSVNG
EPGSVPPPRAHGSFSHVRDADLLKKRRSRLRNSSSFSMDDPDAGAMGAAAAEGQAPDPSP
APGPPTAADSQQPPGGSSPSEEPPPSPGEEAGLQRFQDTSQYVCAELQALEQEQRQIDGR
AAEVEMQLRSLMESGANKLQEEVLIQEWFTLVNKKNALIRRQDQLQLLMEEQDLERRFEL
LSRELRAMLAIEDWQKTSAQQHREQLLLEELVSLVNQRDELVRDLDHKERIALEEDERLE
RGLEQRRRKLSRQLSRRERCVLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N3D4	1.000	1.000	0.000	1523	1.000	1.000	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
2	AFDB:A0A140VK17	0.153	0.191	6.678E-40	1196	0.283	0.360	A0A140VK17.pdb.gz	A0A140VK17_HUMAN EH domain binding protein 1, isoform CRA_a OS=Homo sapiens OX=9606 GN=EHBP1 PE=2 SV=1
3	AFDB:Q9VID5	0.086	0.123	5.439E-9	1039	0.104	0.152	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
4	AFDB:A0A5F8MPU3	0.082	0.058	8.776E-8	2282	0.121	0.081	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
5	AFDB:Q6WKZ4	0.072	0.084	8.776E-8	1283	0.135	0.160	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
6	PDB:1cjyA	0.071	0.162	1.829E-6	633	0.012	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
7	AFDB:Q68CZ2	0.072	0.075	3.579E-6	1445	0.104	0.109	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
8	AFDB:Q4KWH5	0.069	0.063	4.176E-6	1682	0.098	0.089	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
9	AFDB:Q8BI84	0.045	0.040	4.397E-6	1930	0.152	0.120	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
10	AFDB:Q63HR2	0.068	0.073	7.359E-6	1409	0.076	0.082	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
11	AFDB:O70511	0.047	0.035	7.748E-6	2622	0.123	0.071	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
12	PDB:4rj9A	0.068	0.514	2.401E-5	161	0.013	0.124	4rj9A.pdb.gz
13	PDB:5a50A	0.068	0.539	5.764E-5	165	0.013	0.121	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:5a52A	0.068	0.527	7.850E-5	154	0.011	0.104	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5ixcA	0.069	0.148	1.185E-4	684	0.010	0.022	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5izrC	0.066	0.142	1.700E-4	659	0.009	0.021	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:4d1eA	0.068	0.119	1.790E-4	859	0.026	0.045	4d1eA.pdb.gz
18	PDB:5iz5A	0.068	0.130	2.845E-4	757	0.009	0.017	5iz5A.pdb.gz
19	PDB:5iz5B	0.070	0.137	4.761E-4	746	0.009	0.019	5iz5B.pdb.gz
20	PDB:7jvxA	0.066	0.251	5.013E-4	314	0.008	0.038	7jvxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N3D4	0.0	3014	1523	1.000	1.000	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
2	A0A140VK17	2.81e-80	292	1196	0.083	0.105	A0A140VK17_HUMAN EH domain binding protein 1, isoform CRA_a OS=Homo sapiens OX=9606 GN=EHBP1 PE=2 SV=1
3	Q8NDI1	3.54e-80	292	1231	0.083	0.102	EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3
4	Q69ZW3	4.40e-80	292	1231	0.083	0.102	EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ehbp1 PE=1 SV=3
5	B5MC86	1.92e-77	261	310	0.083	0.406	B5MC86_HUMAN EH domain binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=1
6	A4UZL3	1.63e-54	211	1141	0.064	0.086	A4UZL3_DROME Eps15 homology domain containing protein-binding protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Ehbp1 PE=1 SV=1
7	Q3TN34	4.91e-25	115	1009	0.038	0.057	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
8	A8MU46	7.85e-25	112	494	0.037	0.115	SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens OX=9606 GN=SMTNL1 PE=1 SV=2
9	D3ZEN0	9.04e-25	115	1014	0.042	0.063	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
10	Q8IY33	1.82e-24	114	904	0.036	0.061	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
11	E1BBG2	1.88e-24	113	853	0.037	0.067	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
12	Q99LM3	4.27e-24	110	459	0.037	0.122	SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus OX=10090 GN=Smtnl1 PE=1 SV=1
13	D3ZQL6	6.65e-24	112	855	0.033	0.058	MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1
14	Q8BGT6	6.92e-24	112	870	0.033	0.057	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
15	F1QAZ3	1.45e-23	110	783	0.032	0.063	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
16	Q0KHX7	1.25e-22	108	1094	0.029	0.040	Q0KHX7_DROME FI18193p1 OS=Drosophila melanogaster OX=7227 GN=spdi PE=1 SV=1
17	Q9U4H0	1.50e-22	107	949	0.029	0.046	Q9U4H0_DROME EG:118B3.2 OS=Drosophila melanogaster OX=7227 GN=spdi PE=2 SV=1
18	Q9W5E8	1.64e-22	107	950	0.029	0.046	Q9W5E8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=2
19	X2JHS3	1.64e-22	107	949	0.029	0.046	X2JHS3_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=spdi PE=4 SV=1
20	Q7RTP6	4.37e-22	106	2002	0.032	0.024	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12130 bMERB_dom	6.1e-32	122.0	Bivalent Mical/EHBP Rab binding domain
2	PF11971 CAMSAP_CH	0.29	22.3	CAMSAP CH domain
3	PF00307 CH	1.9e-18	78.0	Calponin homology (CH) domain
4	PF10358 NT-C2	4e-17	73.8	N-terminal C2 in EEIG1 and EHBP1 proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319726	0.821	Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface . Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6
2	9606.ENSP00000300935	0.817	Ras-related protein Rab-8A
3	9606.ENSP00000308354	0.812	Tigger transposable element-derived protein 3
4	9606.ENSP00000264710	0.760	Ras-related protein Rab-10
5	9606.ENSP00000436901	0.752	Zinc finger protein ubi-d4
6	9606.ENSP00000312318	0.748	Sjoegren syndrome/scleroderma autoantigen 1
7	9606.ENSP00000412922	0.726	Ubiquitin-related modifier 1
8	9606.ENSP00000483489	0.726	N-terminal Xaa-Pro-Lys N-methyltransferase 1
9	9606.ENSP00000325785	0.716	Cytospin-A
10	9606.ENSP00000312734	0.713	Ras-related protein Rab-8B
11	9606.ENSP00000279249	0.666	Cdc42 effector protein 2
12	9606.ENSP00000215957	0.655	MICAL-like protein 1
13	9606.ENSP00000348099	0.640	PDZ and LIM domain protein 7
14	9606.ENSP00000261503	0.639	Cytospin-B
15	9606.ENSP00000431459	0.639	Leucine repeat adapter protein 25
16	9606.ENSP00000352834	0.638	Unconventional myosin-Ic
17	9606.ENSP00000381782	0.637	Solute carrier family 25 member 45
18	9606.ENSP00000301873	0.635	Latent-transforming growth factor beta-binding protein 3
19	9606.ENSP00000309597	0.635	Mitogen-activated protein kinase kinase kinase 11
20	9606.ENSP00000344820	0.629	Potassium channel subfamily K member 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.442	enzyme binding
GO:0008092	0.384	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.782	biological regulation
GO:0050789	0.678	regulation of biological process
GO:0050794	0.617	regulation of cellular process
GO:0016043	0.528	cellular component organization
GO:0050896	0.371	response to stimulus
GO:0051179	0.342	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043226	0.807	organelle
GO:0005622	0.804	intracellular anatomical structure
GO:0005737	0.791	cytoplasm
GO:0043229	0.791	intracellular organelle
GO:0043227	0.773	membrane-bounded organelle
GO:0071944	0.495	cell periphery
GO:0005886	0.490	plasma membrane
GO:0043231	0.456	intracellular membrane-bounded organelle
GO:0005829	0.437	cytosol
GO:0043228	0.425	non-membrane-bounded organelle
GO:0043232	0.423	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]