StarFunc result for job id Q8N3E9

User Input

>input (789 residues)
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A978	0.913	0.914	0.000	788	0.871	0.872	D4A978.pdb.gz	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
2	AFDB:Q8K2J0	0.934	0.939	0.000	785	0.880	0.884	Q8K2J0.pdb.gz	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
3	AFDB:Q8N3E9	1.000	1.000	0.000	789	1.000	1.000	Q8N3E9.pdb.gz	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
4	AFDB:F1QJ13	0.874	0.897	7.321E-103	769	0.490	0.503	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
5	AFDB:F1Q5G9	0.867	0.898	1.838E-100	761	0.488	0.506	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
6	AFDB:P10688	0.875	0.912	4.872E-98	756	0.475	0.496	P10688.pdb.gz	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
7	AFDB:C9JEA7	0.846	0.841	1.615E-96	794	0.474	0.471	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
8	AFDB:Q9BRC7	0.851	0.880	4.094E-96	762	0.470	0.487	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
9	AFDB:Q62711	0.869	0.888	5.046E-94	772	0.425	0.434	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
10	AFDB:Q8K3R3	0.846	0.828	6.601E-93	807	0.421	0.411	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
11	PDB:4gnkB	0.708	0.725	1.659E-59	769	0.299	0.307	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.146	0.180	5.665E-8	633	0.032	0.039	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.141	0.162	2.621E-7	684	0.027	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5iz5B	0.145	0.153	2.924E-7	746	0.028	0.029	5iz5B.pdb.gz
15	PDB:5iz5A	0.139	0.145	8.267E-7	757	0.027	0.028	5iz5A.pdb.gz
16	PDB:5izrC	0.138	0.164	1.029E-6	659	0.027	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:3pfqA	0.120	0.176	4.760E-6	523	0.042	0.063	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
18	PDB:5a52A	0.124	0.560	5.925E-6	154	0.034	0.175	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:3nsjA	0.124	0.180	7.374E-6	530	0.032	0.047	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:5a50A	0.124	0.545	7.789E-6	165	0.032	0.152	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AGE0	0.0	1333	744	0.826	0.876	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
2	C9JEA7	0.0	716	794	0.464	0.461	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
3	D4A978	0.0	1309	762	0.833	0.862	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
4	F1Q5G9	0.0	754	761	0.485	0.503	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
5	F1QJ13	0.0	776	769	0.488	0.501	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	P10688	0.0	742	756	0.482	0.503	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
7	P51178	0.0	734	756	0.484	0.505	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
8	Q62711	0.0	673	772	0.431	0.440	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	Q8K2J0	0.0	1392	785	0.881	0.885	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
10	Q8N3E9	0.0	1636	789	1.000	1.000	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
11	Q8R3B1	0.0	739	756	0.487	0.508	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
12	Q9BRC7	0.0	724	762	0.464	0.480	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
13	Q8K394	1.56e-153	479	1128	0.357	0.250	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
14	Q9UPR0	4.30e-153	478	1127	0.354	0.248	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
15	Q86YW0	6.95e-149	451	608	0.304	0.395	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
16	Q5FX52	1.16e-148	452	645	0.312	0.381	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
17	Q8K4D7	8.89e-148	449	647	0.309	0.377	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
18	H2LIC9	1.47e-145	444	659	0.311	0.372	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2
19	Q15111	7.42e-138	437	1095	0.347	0.250	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
20	Q3USB7	5.97e-136	432	1096	0.341	0.245	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.9e-12	58.1	C2 domain
2	PF20276 CTD1	5.3e+02	11.5	C-terminal domain 1 of the ABC-three component (ABC-3C) systems
3	PF00036 EF-hand_1	2.4e+02	12.7	EF hand
4	PF14788 EF-hand_10	3.9e-22	89.2	EF hand
5	PF13405 EF-hand_6	0.27	22.2	EF-hand domain
6	PF13499 EF-hand_7	4.5	19.1	EF-hand domain pair
7	PF09279 EF-hand_like	3.1e-20	83.8	Phosphoinositide-specific phospholipase C, efhand-like
8	PF18081 FANC_SAP	1.6e+02	13.9	Fanconi anemia-associated nuclease SAP domain
9	PF00169 PH	26	16.8	PH domain
10	PF00388 PI-PLC-X	3.4e-58	206.8	Phosphatidylinositol-specific phospholipase C, X domain
11	PF00387 PI-PLC-Y	1.9e-35	133.0	Phosphatidylinositol-specific phospholipase C, Y domain
12	PF10591 SPARC_Ca_bdg	1.6e+02	14.0	Secreted protein acidic and rich in cysteine Ca binding region
13	PF01023 S_100	18	16.3	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365757	0.940	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
2	9606.ENSP00000373399	0.938	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
3	9606.ENSP00000265382	0.929	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
4	9606.ENSP00000357883	0.928	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
5	9606.ENSP00000466363	0.926	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
6	9606.ENSP00000347032	0.922	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
7	9606.ENSP00000482548	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
8	9606.ENSP00000306253	0.867	Inositol 1,4,5-trisphosphate receptor type 1
9	9606.ENSP00000363435	0.850	Inositol 1,4,5-trisphosphate receptor type 3
10	9606.ENSP00000408695	0.847	Protein kinase C alpha type
11	9606.ENSP00000370744	0.841	Inositol 1,4,5-trisphosphate receptor type 2
12	9606.ENSP00000360777	0.822	72 kDa inositol polyphosphate 5-phosphatase
13	9606.ENSP00000263431	0.815	Protein kinase C gamma type
14	9606.ENSP00000430344	0.814	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
15	9606.ENSP00000305355	0.813	Protein kinase C beta type
16	9606.ENSP00000388631	0.811	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
17	9606.ENSP00000362115	0.793	Type II inositol 1,4,5-trisphosphate 5-phosphatase
18	9606.ENSP00000347792	0.772	Synaptojanin-2
19	9606.ENSP00000360154	0.769	Inositol polyphosphate 5-phosphatase OCRL-1
20	9606.ENSP00000180173	0.761	Myotubularin-related protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004629	0.997	phospholipase C activity
GO:0004435	0.945	phosphatidylinositol phospholipase C activity
GO:0043167	0.895	ion binding
GO:0008289	0.783	lipid binding
GO:0019899	0.710	enzyme binding
GO:0043168	0.677	anion binding
GO:0005546	0.632	phosphatidylinositol-4,5-bisphosphate binding
GO:0046872	0.580	metal ion binding
GO:0005509	0.509	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0008152	0.894	metabolic process
GO:0032501	0.882	multicellular organismal process
GO:0044237	0.870	cellular metabolic process
GO:0071704	0.846	organic substance metabolic process
GO:0044238	0.816	primary metabolic process
GO:0006796	0.727	phosphate-containing compound metabolic process
GO:0050896	0.706	response to stimulus
GO:0001890	0.699	placenta development
GO:0006629	0.613	lipid metabolic process
GO:0007154	0.562	cell communication
GO:0046486	0.559	glycerolipid metabolic process
GO:0023052	0.558	signaling
GO:0051716	0.556	cellular response to stimulus
GO:0007165	0.543	signal transduction
GO:0007275	0.534	multicellular organism development
GO:0019637	0.494	organophosphate metabolic process
GO:0006650	0.476	glycerophospholipid metabolic process
GO:0001701	0.468	in utero embryonic development
GO:0046488	0.415	phosphatidylinositol metabolic process
GO:0048518	0.378	positive regulation of biological process
GO:0035295	0.329	tube development
GO:0001944	0.324	vasculature development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005886	0.963	plasma membrane
GO:0043227	0.746	membrane-bounded organelle
GO:0043229	0.647	intracellular organelle
GO:0043231	0.617	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.997	Phosphoric diester hydrolases.
RHEA:33179	0.945	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.945	phosphoinositide phospholipase C.

[back to server]