StarFunc result for job id Q8N3J5

User Input

>input (372 residues)
MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPAT
WDNFGIWDNRIDEPILLPPSIKYGKPIPKISLENVGCASQIGKRKENEDRFDFAQLTDEV
LYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSAD
ATLLTSGTTATVALLRDGIELVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKC
GGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI
NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFS
FSRSFASSGRWA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BXN7	0.827	0.827	1.289E-66	372	0.903	0.903	Q8BXN7.pdb.gz	PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus OX=10090 GN=Ppm1k PE=1 SV=1
2	AFDB:F1R0V7	0.823	0.823	2.487E-56	372	0.683	0.683	F1R0V7.pdb.gz
3	AFDB:Q94AT1	0.626	0.556	7.283E-27	420	0.263	0.233	Q94AT1.pdb.gz	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
4	AFDB:Q3EAF9	0.635	0.616	1.891E-26	384	0.317	0.307	Q3EAF9.pdb.gz	P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana OX=3702 GN=At3g62260 PE=2 SV=1
5	AFDB:P49598	0.638	0.597	3.922E-26	399	0.245	0.228	P49598.pdb.gz	P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana OX=3702 GN=PP2CA PE=1 SV=1
6	AFDB:Q9FLI3	0.637	0.571	9.101E-26	416	0.263	0.236	Q9FLI3.pdb.gz	P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana OX=3702 GN=AHG1 PE=1 SV=1
7	AFDB:Q9SLA1	0.653	0.621	2.958E-25	392	0.282	0.268	Q9SLA1.pdb.gz	P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana OX=3702 GN=At2g25620 PE=1 SV=1
8	AFDB:Q9FIF5	0.616	0.558	3.309E-25	413	0.277	0.249	Q9FIF5.pdb.gz	P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana OX=3702 GN=SAG113 PE=1 SV=1
9	AFDB:Q8L7I4	0.611	0.796	3.916E-25	283	0.215	0.283	Q8L7I4.pdb.gz	P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana OX=3702 GN=At1g78200 PE=2 SV=1
10	AFDB:Q9LNW3	0.618	0.523	4.142E-25	442	0.263	0.222	Q9LNW3.pdb.gz	P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana OX=3702 GN=AIP1 PE=1 SV=1
11	PDB:1a6qA	0.612	0.626	3.134E-22	363	0.234	0.240	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
12	PDB:4oicB	0.591	0.715	4.641E-22	305	0.242	0.295	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
13	PDB:4jndA	0.635	0.580	1.687E-21	408	0.175	0.159	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
14	PDB:5nzzD	0.549	0.540	4.596E-16	379	0.196	0.193	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
15	PDB:7kprA	0.554	0.515	3.466E-15	403	0.207	0.191	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
16	PDB:5d2uA	0.532	0.801	4.581E-14	240	0.180	0.279	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
17	PDB:2pk0A	0.509	0.738	6.054E-13	247	0.134	0.202	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
18	PDB:6jkvA	0.470	0.729	3.448E-12	230	0.151	0.243	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.382	0.654	7.106E-8	199	0.105	0.196	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.427	0.379	9.901E-5	427	0.102	0.089	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BXN7	0.0	686	372	0.903	0.903	PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus OX=10090 GN=Ppm1k PE=1 SV=1
2	Q8N3J5	0.0	775	372	1.000	1.000	PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens OX=9606 GN=PPM1K PE=1 SV=1
3	V9GY69	5.71e-112	325	153	0.411	1.000	V9GY69_HUMAN Protein phosphatase, Mg2+/Mn2+ dependent 1K OS=Homo sapiens OX=9606 GN=PPM1K PE=1 SV=1
4	F6PA41	5.55e-66	209	188	0.285	0.564	F6PA41_DANRE Protein phosphatase 1K, mitochondrial isoform X3 OS=Danio rerio OX=7955 GN=im:6912645 PE=4 SV=1
5	Q8LAY8	4.72e-38	141	354	0.255	0.268	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
6	Q4PSE8	6.09e-38	143	447	0.255	0.213	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
7	Q8RXV3	1.78e-36	136	311	0.237	0.283	P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana OX=3702 GN=WIN2 PE=1 SV=1
8	Q5SGD2	1.00e-34	132	360	0.253	0.261	PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens OX=9606 GN=PPM1L PE=1 SV=1
9	Q8BHN0	1.27e-34	132	360	0.253	0.261	PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus OX=10090 GN=Ppm1l PE=1 SV=1
10	Q94AT1	2.69e-34	133	420	0.242	0.214	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
11	Q3EAF9	1.13e-33	130	384	0.272	0.263	P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana OX=3702 GN=At3g62260 PE=2 SV=1
12	Q8L7I4	1.48e-33	127	283	0.242	0.318	P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana OX=3702 GN=At1g78200 PE=2 SV=1
13	Q6EN45	1.96e-33	129	363	0.255	0.262	P2C13_ORYSJ Probable protein phosphatase 2C member 13, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C13 PE=2 SV=1
14	Q9SLA1	7.36e-33	128	392	0.253	0.240	P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana OX=3702 GN=At2g25620 PE=1 SV=1
15	O04719	3.41e-32	127	423	0.263	0.232	P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana OX=3702 GN=ABI2 PE=1 SV=1
16	Q583I2	3.65e-32	125	314	0.239	0.283	Q583I2_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.870 PE=3 SV=1
17	P35182	4.22e-32	124	281	0.218	0.288	PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC1 PE=1 SV=1
18	Q0JLP9	2.06e-30	123	467	0.231	0.184	P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C06 PE=1 SV=1
19	P49597	7.88e-30	120	434	0.239	0.205	P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana OX=3702 GN=ABI1 PE=1 SV=2
20	P40371	1.02e-29	119	347	0.212	0.228	PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	2.8e-53	192.8	Protein phosphatase 2C
2	PF13672 PP2C_2	2.4e-06	38.9	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477341

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269980	0.996	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
2	9606.ENSP00000318351	0.994	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
3	9606.ENSP00000359151	0.977	Dihydrolipoamide branched chain transacylase E2
4	9606.ENSP00000205402	0.925	Dihydrolipoyl dehydrogenase, mitochondrial
5	9606.ENSP00000378405	0.845	[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
6	9606.ENSP00000379503	0.788	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
7	9606.ENSP00000228705	0.766	Protein phosphatase 1H
8	9606.ENSP00000337358	0.740	Haloacid dehalogenase-like hydrolase domain-containing 5
9	9606.ENSP00000309548	0.698	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
10	9606.ENSP00000346255	0.673	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
11	9606.ENSP00000477613	0.623	Baculoviral IAP repeat-containing protein 2
12	9606.ENSP00000322991	0.610	Branched-chain-amino-acid aminotransferase, mitochondrial
13	9606.ENSP00000215570	0.605	Mitochondrial import inner membrane translocase subunit Tim13
14	9606.ENSP00000387046	0.593	Protein phosphatase, Mg2+/Mn2+ dependent 1M
15	9606.ENSP00000360268	0.566	Delta-1-pyrroline-5-carboxylate synthase
16	9606.ENSP00000308926	0.550	Belongs to the PP2C family
17	9606.ENSP00000392147	0.550	Protein phosphatase 6 catalytic subunit
18	9606.ENSP00000464976	0.535	Zinc finger protein 850
19	9606.ENSP00000279387	0.502	Serine/threonine-protein phosphatase 4 catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	0.999	phosphoprotein phosphatase activity
GO:0004722	0.977	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.940	primary metabolic process
GO:0071704	0.932	organic substance metabolic process
GO:0050794	0.928	regulation of cellular process
GO:0006807	0.905	nitrogen compound metabolic process
GO:1901564	0.836	organonitrogen compound metabolic process
GO:0043170	0.512	macromolecule metabolic process
GO:0048519	0.457	negative regulation of biological process
GO:0048523	0.416	negative regulation of cellular process
GO:0006796	0.390	phosphate-containing compound metabolic process
GO:0019538	0.365	protein metabolic process
GO:0019222	0.307	regulation of metabolic process
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.921	mitochondrial matrix
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.977	protein-serine/threonine phosphatase.

[back to server]