StarFunc result for job id Q8N3P4

User Input

>input (1428 residues)
MENEPDHENVEQSLCAKTSEEELNKSFNLEASLSKFSYIDMDKELEFKNDLIDDKEFDIP
QVDTPPTLESILNETDDEDESFILEDPTLLNIDTIDSHSYDTSSVASSDSGDRTNLKRKK
KLPDSFSLHGSVMRHSLLKGISAQIVSAADKVDAGLPTAIAVSSLIAVGTSHGLALIFGK
DQNQALRLCLGSTSVGGQYGAISALSINNDCSRLLCGFAKGQITMWDLASGKLLRSITDA
HPPGTAILHIKFTDDPTLAICNDSGGSVFELTFKRVMGVRTCESRCLFSGSKGEVCCIEP
LHSKPELKDHPITQFSLLAMASLTKILVIGLKPSLKVWMTFPYGRMDPSSVPLLAWHFVA
VQNYVNPMLAFCRGDVVHFLLVKRDESGAIHVTKQKHLHLYYDLINFTWINSRTVVLLDS
VEKLHVIDRQTQEELETVEISEVQLVYNSSHFKSLATGGNVSQALALVGEKACYQSISSY
GGQIFYLGTKSVYVMMLRSWRERVDHLLKQDCLTEALALAWSFHEGKAKAVVGLSGDASK
RKAIVADRMVEILFHYADRALKKCPDQGKIQVMEQHFQDMVPVIVDYCLLLQRKDLLFSQ
MYDKLSENSVAKGVFLECLEPYILSDKLVGITPQVMKDLIVHFQDKKLMENVEALIVHMD
ITSLDIQQVVLMCWENRLYDAMIYVYNRGMNEFISPMEKLFRVIAPPLNAGKTLTDEQVV
MGNKLLVYISCCLAGRAYPLGDIPEDLVPLVKNQVFEFLIRLHSAEASPEEEIYPYIRTL
LHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLAR
QLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMA
EKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQK
AMDHIEELVSLKPCKAAELVATHFSGHIETVIKKLQNQVLLFKFLRSLLDPREGIHVNQE
LLQISPCITEQFIELLCQFNPTQVIETLQVLECYRLEETIQITQKYQLHEVTAYLLEKKG
DIHGAFLIMLERLQSKLQEVTHQGENTKEDPSLKDVEDTMVETIALCQRNSHNLNQQQRE
ALWFPLLEAMMAPQKLSSSAIPHLHSEALKSLTMQVLNSMAAFIALPSILQRILQDPVYG
KGKLGEIQGLILGMLDTFNYEQTLLETTTSLLNQDLHWSLCNLRASVTRGLNPKQDYCSI
CLQQYKRRQEMADEIIVFSCGHLYHSFCLQNKECTVEFEGQTRWTCYKCSSSNKVGKLSE
NSSEIKKGRITPSQVKMSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRL
ALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N3P4	1.000	1.000	0.000	1428	1.000	1.000	Q8N3P4.pdb.gz	VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens OX=9606 GN=VPS8 PE=1 SV=3
2	AFDB:Q9VRX2	0.476	0.547	1.782E-78	1229	0.279	0.324	Q9VRX2.pdb.gz	VPS8_DROME Vacuolar protein sorting-associated protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Vps8 PE=1 SV=1
3	AFDB:F4JHM9	0.408	0.317	6.975E-61	1913	0.244	0.182	F4JHM9.pdb.gz	F4JHM9_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=SETH5 PE=1 SV=1
4	AFDB:P39702	0.406	0.446	5.241E-42	1274	0.151	0.169	P39702.pdb.gz	VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS8 PE=1 SV=2
5	PDB:1xi4A	0.175	0.156	5.587E-14	1630	0.114	0.100	1xi4A.pdb.gz
6	PDB:7vciR	0.167	0.210	2.610E-13	1082	0.111	0.146	7vciR.pdb.gz
7	PDB:7qpgR	0.173	0.124	6.207E-12	2208	0.104	0.067	7qpgR.pdb.gz
8	PDB:7zu0A	0.206	0.288	6.207E-12	954	0.092	0.137	7zu0A.pdb.gz
9	PDB:7r5jR0	0.163	0.166	1.130E-11	1399	0.106	0.109	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
10	PDB:7r5jD4	0.189	0.204	1.810E-11	1312	0.108	0.117	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
11	PDB:7mqaLQ	0.167	0.276	2.778E-11	830	0.054	0.093	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:X1WE68	0.202	0.122	1.819E-10	2527	0.117	0.066	X1WE68.pdb.gz
13	PDB:7mq8LO	0.153	0.248	3.329E-10	848	0.053	0.090	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LJ	0.171	0.463	1.624E-9	469	0.045	0.136	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6qk7A	0.151	0.181	2.011E-9	1161	0.077	0.095	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
16	AFDB:O13286	0.171	0.412	2.971E-8	556	0.041	0.106	O13286.pdb.gz	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1
17	AFDB:Q09649	0.168	0.328	5.183E-8	702	0.047	0.095	Q09649.pdb.gz	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
18	AFDB:Q9SYX2	0.175	0.237	2.528E-7	1029	0.041	0.056	Q9SYX2.pdb.gz	SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana OX=3702 GN=SPA1 PE=1 SV=1
19	AFDB:O14306	0.170	0.200	4.225E-7	1191	0.050	0.060	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
20	AFDB:F4JC31	0.087	0.122	2.060E-6	886	0.088	0.142	F4JC31.pdb.gz	F4JC31_ARATH Binding protein OS=Arabidopsis thaliana OX=3702 GN=SMEK1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0P5W1	0.0	2770	1427	0.934	0.935	VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus OX=10090 GN=Vps8 PE=1 SV=1
2	Q8N3P4	0.0	2965	1428	1.000	1.000	VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens OX=9606 GN=VPS8 PE=1 SV=3
3	Q9VRX2	0.0	614	1229	0.291	0.338	VPS8_DROME Vacuolar protein sorting-associated protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Vps8 PE=1 SV=1
4	F4JHM9	6.04e-98	350	1913	0.237	0.177	F4JHM9_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=SETH5 PE=1 SV=1
5	P39702	5.06e-16	86.7	1274	0.060	0.067	VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS8 PE=1 SV=2
6	O13756	1.75e-07	58.5	1272	0.041	0.046	VPS8_SCHPO Vacuolar protein sorting-associated protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps8 PE=3 SV=1
7	Q9H6Y7	0.078	39.7	350	0.015	0.060	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1
8	Q9M3B4	0.080	39.7	438	0.015	0.050	RID3_ARATH Protein ROOT INITIATION DEFECTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=RID3 PE=1 SV=1
9	A3KPR1	0.082	40.0	896	0.018	0.029	A3KPR1_DANRE WD repeat domain 36 OS=Danio rerio OX=7955 GN=wu:fb33e10 PE=1 SV=1
10	Q383N1	0.086	40.0	975	0.018	0.026	Q383N1_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2250 PE=4 SV=1
11	Q9D4T2	0.12	38.9	304	0.016	0.076	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	Q9W235	0.13	39.3	1171	0.020	0.025	Q9W235_DROME FI01301p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
13	Q95SP7	0.15	38.9	1045	0.020	0.028	Q95SP7_DROME GH09832p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
14	Q944S8	0.18	34.7	68	0.015	0.309	Q944S8_ARATH At4g21108/At4g21108 OS=Arabidopsis thaliana OX=3702 GN=At4g21105 PE=1 SV=1
15	D3YZQ8	0.22	38.1	356	0.016	0.065	D3YZQ8_MOUSE Dynein assembly factor with WDR repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=1 SV=1
16	P22219	0.24	38.5	1454	0.015	0.014	VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS15 PE=1 SV=4
17	Q9C1X1	0.24	38.5	854	0.027	0.044	PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.04c PE=1 SV=1
18	P12868	0.27	38.1	1029	0.015	0.021	PEP5_YEAST E3 ubiquitin-protein ligase PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP5 PE=1 SV=2
19	P25635	0.29	38.1	923	0.019	0.029	PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP2 PE=1 SV=2
20	A6H6T7	0.31	37.4	310	0.016	0.074	A6H6T7_MOUSE Dynein assembly factor with WDR repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00637 Clathrin	2.7e-05	35.5	Region in Clathrin and VPS
2	PF02212 GED	8.4e+02	11.6	Dynamin GTPase effector domain
3	PF00628 PHD	50	15.2	PHD-finger
4	PF19097 Snu56_snRNP	87	13.3	Snu56-like U1 small nuclear ribonucleoprotein component
5	PF12816 Vps8	2.9e-54	195.2	Golgi CORVET complex core vacuolar protein 8
6	PF17122 zf-C3H2C3	31	16.0	Zinc-finger
7	PF00097 zf-C3HC4	5.6e+02	11.8	Zinc finger, C3HC4 type (RING finger)
8	PF17123 zf-RING_11	0.17	23.0	RING-like zinc finger
9	PF13639 zf-RING_2	29	16.4	Ring finger domain
10	PF14634 zf-RING_5	32	15.9	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	7.4	18.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377027	0.999	Transforming growth factor-beta receptor-associated protein 1
2	9606.ENSP00000481126	0.999	Vacuolar protein sorting-associated protein 11 homolog
3	9606.ENSP00000220509	0.998	Vacuolar protein sorting-associated protein 18 homolog
4	9606.ENSP00000369810	0.996	Vacuolar protein sorting-associated protein 16 homolog
5	9606.ENSP00000267199	0.995	Vacuolar protein sorting-associated protein 33A
6	9606.ENSP00000335193	0.995	Vam6/Vps39-like protein
7	9606.ENSP00000327650	0.980	Vacuolar protein sorting-associated protein 33B
8	9606.ENSP00000273047	0.958	Ras-related protein Rab-5A
9	9606.ENSP00000309457	0.899	Vacuolar protein sorting-associated protein 41 homolog
10	9606.ENSP00000358126	0.897	Vacuolar protein sorting-associated protein 45
11	9606.ENSP00000265062	0.857	Ras-related protein Rab-7a
12	9606.ENSP00000447053	0.839	Ras-related protein Rab-5C
13	9606.ENSP00000452181	0.835	Spermatogenesis-defective protein 39 homolog
14	9606.ENSP00000367299	0.828	Vacuolar protein-sorting-associated protein 36
15	9606.ENSP00000468367	0.810	Uncharacterized protein
16	9606.ENSP00000353444	0.805	Ras-related protein Rab-5B
17	9606.ENSP00000306123	0.743	RNA polymerase II-associated protein 1
18	9606.ENSP00000331201	0.735	Hepatocyte growth factor-regulated tyrosine kinase substrate
19	9606.ENSP00000253794	0.732	Vacuolar protein-sorting-associated protein 25
20	9606.ENSP00000479762	0.730	Ras-related protein Rab-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.387	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006906	0.986	vesicle fusion
GO:0051649	0.457	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0032991	0.992	protein-containing complex
GO:0005769	0.932	early endosome
GO:0005829	0.916	cytosol
GO:0016020	0.885	membrane
GO:0099023	0.820	vesicle tethering complex
GO:0098588	0.478	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]