StarFunc result for job id Q8N3R9

User Input

>input (675 residues)
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVK
ILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPF
PLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A3Q1LY00	0.684	0.684	0.000	675	0.982	0.982	A0A3Q1LY00.pdb.gz	A0A3Q1LY00_BOVIN Protein PALS1 OS=Bos taurus OX=9913 GN=PALS1 PE=1 SV=1
2	AFDB:Q8JHF4	0.647	0.646	1.044E-96	677	0.760	0.758	Q8JHF4.pdb.gz	PAL1A_DANRE Protein PALS1 OS=Danio rerio OX=7955 GN=pals1a PE=1 SV=2
3	AFDB:Q9W3H7	0.557	0.430	1.700E-66	879	0.458	0.352	Q9W3H7.pdb.gz	Q9W3H7_DROME RE21473p OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=2
4	AFDB:X2JIZ6	0.554	0.323	2.742E-64	1173	0.458	0.263	X2JIZ6.pdb.gz	X2JIZ6_DROME Stardust, isoform P OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
5	AFDB:E2QD98	0.560	0.192	1.288E-63	2020	0.458	0.153	E2QD98.pdb.gz	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
6	AFDB:Q5T2T1	0.553	0.643	2.942E-54	576	0.319	0.373	Q5T2T1.pdb.gz	MPP7_HUMAN MAGUK p55 subfamily member 7 OS=Homo sapiens OX=9606 GN=MPP7 PE=1 SV=1
7	AFDB:A1Z8G0	0.561	0.631	3.285E-54	595	0.301	0.341	A1Z8G0.pdb.gz	A1Z8G0_DROME Menage a trois, isoform A OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
8	AFDB:Q8T5S9	0.558	0.669	7.525E-54	556	0.290	0.353	Q8T5S9.pdb.gz	Q8T5S9_DROME GH12103p OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
9	AFDB:Q17549	0.541	0.546	1.572E-52	668	0.329	0.332	Q17549.pdb.gz	Q17549_CAEEL MAGUK p55 subfamily member 5 OS=Caenorhabditis elegans OX=6239 GN=magu-2 PE=1 SV=1
10	AFDB:O88954	0.525	0.602	2.314E-52	585	0.301	0.347	O88954.pdb.gz	MPP3_RAT MAGUK p55 subfamily member 3 OS=Rattus norvegicus OX=10116 GN=Mpp3 PE=1 SV=3
11	PDB:2xkxA	0.357	0.336	3.689E-29	721	0.190	0.178	2xkxA.pdb.gz
12	PDB:1lvgA	0.220	0.666	2.000E-17	190	0.104	0.368	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
13	PDB:4f4jA	0.251	0.800	3.882E-17	189	0.104	0.370	4f4jA.pdb.gz
14	PDB:6nuiA	0.255	0.791	1.069E-15	198	0.104	0.354	6nuiA.pdb.gz
15	PDB:1z6gA	0.227	0.689	7.392E-15	191	0.079	0.277	1z6gA.pdb.gz
16	PDB:1z8fA	0.240	0.777	3.166E-13	184	0.073	0.266	1z8fA.pdb.gz
17	PDB:2anbA	0.214	0.604	3.346E-13	206	0.083	0.272	2anbA.pdb.gz	Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
18	PDB:7mixC	0.183	0.343	1.570E-9	324	0.083	0.173	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
19	PDB:3iijA	0.163	0.491	5.386E-5	175	0.036	0.137	3iijA.pdb.gz	hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
20	PDB:7pc3A	0.120	0.198	7.930E-5	405	0.030	0.049	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3Q1LY00	0.0	1381	675	0.982	0.982	A0A3Q1LY00_BOVIN Protein PALS1 OS=Bos taurus OX=9913 GN=PALS1 PE=1 SV=1
2	B4F7E7	0.0	1362	675	0.969	0.969	PALS1_RAT Protein PALS1 OS=Rattus norvegicus OX=10116 GN=Pals1 PE=1 SV=1
3	E2QY99	0.0	1383	675	0.982	0.982	PALS1_CANLF Protein PALS1 OS=Canis lupus familiaris OX=9615 GN=PALS1 PE=1 SV=1
4	Q8JHF4	0.0	1009	677	0.766	0.764	PAL1A_DANRE Protein PALS1 OS=Danio rerio OX=7955 GN=pals1a PE=1 SV=2
5	Q8N3R9	0.0	1398	675	1.000	1.000	PALS1_HUMAN Protein PALS1 OS=Homo sapiens OX=9606 GN=PALS1 PE=1 SV=3
6	Q9JLB2	0.0	1361	675	0.967	0.967	PALS1_MOUSE Protein PALS1 OS=Mus musculus OX=10090 GN=Pals1 PE=1 SV=1
7	Q9W3H7	2.34e-168	506	879	0.375	0.288	Q9W3H7_DROME RE21473p OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=2
8	Q6NR03	9.92e-168	504	859	0.375	0.295	Q6NR03_DROME RE05272p OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
9	Q0KHU9	1.95e-166	503	934	0.375	0.271	Q0KHU9_DROME Stardust, isoform H OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
10	X2JIZ6	3.98e-164	504	1173	0.375	0.216	X2JIZ6_DROME Stardust, isoform P OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
11	Q9W3H6	8.22e-164	506	1292	0.375	0.196	Q9W3H6_DROME Stardust, isoform B OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=2
12	Q8WRS3	8.94e-164	506	1289	0.375	0.196	Q8WRS3_DROME Stardust protein MAGUK1 isoform OS=Drosophila melanogaster OX=7227 GN=sdt PE=2 SV=1
13	Q9W3H8	1.16e-163	505	1269	0.375	0.199	Q9W3H8_DROME Stardust, isoform I OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=4
14	Q7KVT3	1.01e-162	505	1367	0.375	0.185	Q7KVT3_DROME Stardust, isoform E OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
15	X2JCZ1	3.57e-161	506	1606	0.375	0.158	X2JCZ1_DROME Stardust, isoform O OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
16	M9PJD0	4.30e-160	507	1901	0.375	0.133	M9PJD0_DROME Stardust, isoform M OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
17	E2QD98	1.94e-159	507	2020	0.375	0.125	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
18	M9NG38	6.84e-156	490	1527	0.373	0.165	M9NG38_DROME Stardust, isoform J OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
19	M9NEZ2	1.97e-154	492	1941	0.373	0.130	M9NEZ2_DROME Stardust, isoform L OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
20	B7YZF0	1.97e-124	383	585	0.314	0.362	B7YZF0_DROME Menage a trois, isoform C OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18122 APC1_C	5e+02	12.1	Anaphase-promoting complex sub unit 1 C-terminal domain
2	PF19954 EAD10	1.1e+02	14.3	Effector-associated domain 10
3	PF00625 Guanylate_kin	5e-49	178.0	Guanylate kinase
4	PF02828 L27	0.0038	28.3	L27 domain
5	PF09060 L27_N	3.7e-20	83.0	L27_N
6	PF00595 PDZ	4e-08	44.8	PDZ domain
7	PF13180 PDZ_2	0.13	24.0	PDZ domain
8	PF17820 PDZ_6	0.0001	33.4	PDZ domain
9	PF02163 Peptidase_M50	16	16.2	Peptidase family M50
10	PF00018 SH3_1	0.0098	26.8	SH3 domain
11	PF07653 SH3_2	7.5e-08	43.4	Variant SH3 domain
12	PF14604 SH3_9	0.91	20.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360200	0.999	InaD-like protein
2	9606.ENSP00000349204	0.997	Protein crumbs homolog 3
3	9606.ENSP00000356370	0.997	Protein crumbs homolog 1
4	9606.ENSP00000447488	0.997	Protein lin-7 homolog A
5	9606.ENSP00000361027	0.996	Angiomotin
6	9606.ENSP00000439807	0.995	Multiple PDZ domain protein
7	9606.ENSP00000278193	0.966	Protein lin-7 homolog C
8	9606.ENSP00000219255	0.962	Partitioning defective 6 homolog alpha
9	9606.ENSP00000360672	0.957	Partitioning defective 6 homolog beta
10	9606.ENSP00000299106	0.950	Junctional adhesion molecule C
11	9606.ENSP00000363921	0.949	Partitioning defective 3 homolog
12	9606.ENSP00000343144	0.945	Partitioning defective 6 homolog gamma
13	9606.ENSP00000362734	0.941	Protein crumbs homolog 2
14	9606.ENSP00000221459	0.911	Protein lin-7 homolog B
15	9606.ENSP00000362680	0.901	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000289968	0.886	Rho GTPase-activating protein 17
17	9606.ENSP00000263713	0.883	Band 4.1-like protein 5
18	9606.ENSP00000387278	0.852	MAGUK p55 subfamily member 4
19	9606.ENSP00000424765	0.840	Angiomotin-like protein 2
20	9606.ENSP00000367398	0.838	Nephrocystin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032502	0.977	developmental process
GO:0048856	0.970	anatomical structure development
GO:0051179	0.940	localization
GO:0032501	0.930	multicellular organismal process
GO:0065007	0.886	biological regulation
GO:0050789	0.883	regulation of biological process
GO:0071840	0.844	cellular component organization or biogenesis
GO:0050794	0.840	regulation of cellular process
GO:0007275	0.832	multicellular organism development
GO:0009653	0.803	anatomical structure morphogenesis
GO:0007399	0.747	nervous system development
GO:0016043	0.726	cellular component organization
GO:0048869	0.724	cellular developmental process
GO:0033036	0.695	macromolecule localization
GO:0060429	0.664	epithelium development
GO:0051641	0.658	cellular localization
GO:0008104	0.653	protein localization
GO:0002009	0.506	morphogenesis of an epithelium
GO:0002011	0.420	morphogenesis of an epithelial sheet
GO:0048583	0.371	regulation of response to stimulus
GO:0044085	0.342	cellular component biogenesis
GO:0022607	0.320	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005622	0.999	intracellular anatomical structure
GO:0005886	0.999	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005911	0.988	cell-cell junction
GO:0005737	0.982	cytoplasm
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0005576	0.965	extracellular region
GO:0005829	0.938	cytosol
GO:0005615	0.928	extracellular space
GO:1903561	0.922	extracellular vesicle
GO:0070062	0.898	extracellular exosome
GO:0005634	0.884	nucleus
GO:0005912	0.710	adherens junction
GO:0045177	0.490	apical part of cell
GO:0031981	0.365	nuclear lumen
GO:0031090	0.321	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]