StarFunc result for job id Q8N3T6

User Input

>input (1108 residues)
MRSEGAAPGPAAPLCGALSLLLGALLGKVIEGHGVTDNIQRFSSLPPYLPVSYHILRAET
SFFLKEANQDLLRNSSLQARVESFFTYKTRQPPVLNASYGPFSVEKVVPLDLMLTSNFLG
PTNKFSFDWKLKAHILRDKVYLSRPKVQVLFHIMGRDWDDHGAGEKLPCLRVFAFRETRE
VRGSCRLKGDLGLCVAELELLSSWFSAPTVGAGRKKSMDQPEGTPVELYYTVHPGNERGD
CAGGDFRKGNAIRPGKDGLEETTSHLQRIGTVGLYRAQDSAQLSELRLDGNVVIWLPSRP
VKQGEVVTAYVTISSNSSVDLFILRAKVKKGVNILSAQTREPRQWGVKQEVGSGGKHVTA
TVACQRLGPSPRNRSSSLFNEVVQMNFEIASFSSLSGTQPITWQVEYPRKGTTDIAVSEI
FVSQKDLVGIVPLAMDTEILNTAVLTGKTVAMPIKVVSVEENSAVMDISESVECKSTDED
VIKVSERCDYIFVNGKEIKGKMDAVVNFTYQYLSAPLCVTVWVPRLPLQIEVSDTELSQI
KGWRVPIVTNKRPTRESEDEDEEERRGRGCALQYQHATVRVLTQFVSEGAGPWGQPNYLL
SPNWQFDITHLVADFMKLEEPHVATLQDSRVLVGREVGMTTIQVLSPLSDSILAEKTITV
LDDKVSVTDLAIQLVAGLSVALYPNAENSKAVTAVVTAEEVLRTPKQEAVFSTWLQFSDG
SVTPLDIYDTKDFSLAATSQDEAVVSVPQPRSPRWPVVVAEGEGQGPLIRVDMTIAEACQ
KSKRKSILAVGVGNVRVKFGQNDADSSPGGDYEEDEIKNHASDRRQKGQHHERTGQDGHL
YGSSPVEREEGALRRATTTARSLLDNKVVKNSRADGGRLAGEGQLQNIPIDFTNFPAHVD
LPKAGSGLEENDLVQTPRGLSDLEIGMYALLGVFCLAILVFLINCATFALKYRHKQVPLE
GQASMTHSHDWVWLGNEAELLESMGDAPPPQDEHTTIIDRGPGACEESNHLLLNGGSHKH
VQSQIHRSADSGGRQGREQKQDPLHSPTSKRKKVKFTTFTTIPPDDSCPTVNSIVSSNDE
DIKWVCQDVAVGAPKELRNYLEKLKDKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14C87	0.714	0.720	0.000	1099	0.604	0.609	Q14C87.pdb.gz	T132D_HUMAN Transmembrane protein 132D OS=Homo sapiens OX=9606 GN=TMEM132D PE=1 SV=1
2	AFDB:Q76HP2	0.700	0.707	0.000	1097	0.551	0.557	Q76HP2.pdb.gz	T132D_RAT Transmembrane protein 132D OS=Rattus norvegicus OX=10116 GN=Tmem132d PE=2 SV=1
3	AFDB:Q80WF4	0.566	0.610	1.029E-86	1021	0.327	0.355	Q80WF4.pdb.gz	T132A_RAT Transmembrane protein 132A OS=Rattus norvegicus OX=10116 GN=Tmem132a PE=1 SV=1
4	AFDB:Q24JP5	0.593	0.640	1.933E-86	1023	0.327	0.354	Q24JP5.pdb.gz	T132A_HUMAN Transmembrane protein 132A OS=Homo sapiens OX=9606 GN=TMEM132A PE=1 SV=1
5	AFDB:P13595	0.088	0.088	1.490E-13	1115	0.119	0.118	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
6	AFDB:Q80TE2	0.085	0.086	8.776E-12	1098	0.144	0.146	Q80TE2.pdb.gz	Q80TE2_MOUSE MKIAA1400 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
7	AFDB:P97603	0.092	0.082	1.649E-11	1377	0.120	0.097	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
8	AFDB:F7BJK1	0.103	0.105	3.252E-11	1077	0.119	0.123	F7BJK1.pdb.gz	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
9	AFDB:Q9HCL0	0.078	0.076	3.762E-11	1135	0.099	0.097	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
10	AFDB:A0A2R8RMH2	0.080	0.078	5.033E-11	1150	0.106	0.103	A0A2R8RMH2.pdb.gz
11	PDB:4aq1A	0.096	0.133	6.007E-10	721	0.060	0.092	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:5a42A	0.103	0.079	9.296E-10	1597	0.087	0.060	5a42A.pdb.gz
13	PDB:7q1yA	0.099	0.086	1.510E-9	1374	0.079	0.064	7q1yA.pdb.gz
14	PDB:7sqcO0	0.097	0.095	2.575E-9	1140	0.072	0.070	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:4rtdA	0.086	0.085	2.399E-8	1122	0.069	0.068	4rtdA.pdb.gz
16	PDB:4ziqA	0.095	0.076	2.913E-8	1450	0.074	0.057	4ziqA.pdb.gz
17	PDB:1e07A	0.079	0.117	1.445E-7	642	0.066	0.114	1e07A.pdb.gz
18	PDB:7q5zA	0.094	0.080	1.592E-7	1344	0.074	0.061	7q5zA.pdb.gz
19	PDB:3fcsA	0.102	0.119	2.714E-7	913	0.060	0.073	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
20	PDB:4lnvA	0.103	0.093	5.620E-7	1276	0.067	0.058	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	L7VG99	0.0	802	1073	0.408	0.421	T132E_DANRE Transmembrane protein 132E OS=Danio rerio OX=7955 GN=tmem132e PE=2 SV=1
2	Q14C87	0.0	1295	1099	0.600	0.605	T132D_HUMAN Transmembrane protein 132D OS=Homo sapiens OX=9606 GN=TMEM132D PE=1 SV=1
3	Q6IEE6	0.0	747	1074	0.411	0.424	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
4	Q6IEE7	0.0	625	1074	0.319	0.330	T132E_HUMAN Transmembrane protein 132E OS=Homo sapiens OX=9606 GN=TMEM132E PE=1 SV=2
5	Q76HP2	0.0	1201	1097	0.551	0.557	T132D_RAT Transmembrane protein 132D OS=Rattus norvegicus OX=10116 GN=Tmem132d PE=2 SV=1
6	Q922P8	2.12e-171	533	1018	0.323	0.352	T132A_MOUSE Transmembrane protein 132A OS=Mus musculus OX=10090 GN=Tmem132a PE=1 SV=2
7	Q24JP5	1.11e-141	454	1023	0.255	0.277	T132A_HUMAN Transmembrane protein 132A OS=Homo sapiens OX=9606 GN=TMEM132A PE=1 SV=1
8	Q80WF4	1.17e-132	431	1021	0.249	0.270	T132A_RAT Transmembrane protein 132A OS=Rattus norvegicus OX=10116 GN=Tmem132a PE=1 SV=1
9	E7FKV8	1.0	36.2	2742	0.020	0.008	PK1L1_ORYLA Polycystin-1-like protein 1 OS=Oryzias latipes OX=8090 GN=pkd1l1 PE=1 SV=2
10	Q54TI1	2.3	34.7	575	0.018	0.035	Q54TI1_DICDI Transmembrane protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281735 PE=4 SV=1
11	P77172	3.9	33.9	747	0.022	0.032	PDEF_ECOLI Cyclic di-GMP phosphodiesterase PdeF OS=Escherichia coli (strain K12) OX=83333 GN=pdeF PE=1 SV=1
12	P32892	4.2	33.9	752	0.016	0.024	DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16070 TMEM132	1.3e-141	483.6	Transmembrane protein family 132
2	PF15706 TMEM132D_C	9.5e-34	126.4	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term
3	PF15705 TMEM132D_N	2e-54	194.4	Mature oligodendrocyte transmembrane protein, TMEM132D, N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410852

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305011	0.685	Olfactory receptor 4K14
2	9606.ENSP00000266771	0.650	Solute carrier family 15 member 4
3	9606.ENSP00000407107	0.632	HERV-H LTR-associating 1
4	9606.ENSP00000332110	0.628	Olfactory receptor 4N5
5	9606.ENSP00000281703	0.627	Glycosyltransferase 1 domain-containing protein 1
6	9606.ENSP00000340761	0.617	BRI3-binding protein
7	9606.ENSP00000354227	0.613	Type 2 DNA topoisomerase 6 subunit B-like
8	9606.ENSP00000362206	0.589	Kelch-like protein 4
9	9606.ENSP00000384040	0.587	Coiled-coil domain containing 85A
10	9606.ENSP00000472808	0.583	Zinc finger protein 473
11	9606.ENSP00000362171	0.562	Nucleosome assembly protein 1 like 3
12	9606.ENSP00000308012	0.536	Polyadenylate-binding protein 5
13	9606.ENSP00000254624	0.531	Protein EFR3 homolog A
14	9606.ENSP00000311135	0.527	Probable ATP-dependent RNA helicase DHX37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0048513	0.955	animal organ development
GO:0032501	0.941	multicellular organismal process
GO:0065007	0.895	biological regulation
GO:0050896	0.865	response to stimulus
GO:0030855	0.864	epithelial cell differentiation
GO:0007275	0.854	multicellular organism development
GO:0050789	0.807	regulation of biological process
GO:0007423	0.795	sensory organ development
GO:0048731	0.794	system development
GO:0008544	0.716	epidermis development
GO:0050794	0.715	regulation of cellular process
GO:0042490	0.696	mechanoreceptor differentiation
GO:0009913	0.652	epidermal cell differentiation
GO:0048468	0.625	cell development
GO:0043583	0.576	ear development
GO:0035315	0.563	hair cell differentiation
GO:0048666	0.344	neuron development
GO:0051716	0.303	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0005622	0.838	intracellular anatomical structure
GO:0043226	0.653	organelle
GO:0043229	0.509	intracellular organelle
GO:0043227	0.452	membrane-bounded organelle
GO:0043231	0.436	intracellular membrane-bounded organelle
GO:0071944	0.381	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]