StarFunc result for job id Q8N3U4

User Input

>input (1231 residues)
MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGG
GKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINF
FIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG
VLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIN
MDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA
IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKEL
NSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYL
VDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVG
RGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIY
TTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDE
LADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGI
ENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVN
TTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDII
KETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFG
LDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYV
YLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTG
KRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMS
VYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPP
SKNRRERTELKPDFFDPASIMDESVLGVSMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35638	0.870	0.870	0.000	1231	0.991	0.991	O35638.pdb.gz	STAG2_MOUSE Cohesin subunit SA-2 OS=Mus musculus OX=10090 GN=Stag2 PE=1 SV=3
2	AFDB:Q9DGN0	0.831	0.856	0.000	1194	0.863	0.889	Q9DGN0.pdb.gz	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
3	AFDB:Q9DGN1	0.860	0.838	3.165E-96	1265	0.699	0.680	Q9DGN1.pdb.gz	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
4	PDB:6qnxA	0.746	0.987	4.030E-88	928	0.751	0.996	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
5	AFDB:D6W5U7	0.769	0.772	2.027E-74	1226	0.479	0.481	D6W5U7.pdb.gz	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
6	PDB:6wg3D	0.716	0.935	2.514E-72	932	0.608	0.803	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
7	AFDB:Q9VM62	0.722	0.785	1.010E-61	1127	0.379	0.413	Q9VM62.pdb.gz	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
8	AFDB:Q19555	0.728	0.814	1.443E-52	1096	0.299	0.336	Q19555.pdb.gz	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
9	AFDB:O82265	0.636	0.706	2.690E-36	1098	0.210	0.236	O82265.pdb.gz	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
10	PDB:6h8qA	0.515	0.698	2.777E-14	879	0.128	0.179	6h8qA.pdb.gz	Structural basis for Scc3-dependent cohesin recruitment to chromatin.
11	AFDB:Q96UP3	0.137	0.126	6.040E-7	1400	0.115	0.101	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
12	PDB:3w3uA	0.215	0.245	8.759E-7	1030	0.097	0.116	3w3uA.pdb.gz
13	PDB:5oqrA	0.218	0.313	1.386E-6	751	0.082	0.134	5oqrA.pdb.gz
14	PDB:4jlqA	0.174	0.224	1.488E-6	840	0.089	0.131	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	AFDB:O35821	0.144	0.138	2.153E-6	1344	0.124	0.114	O35821.pdb.gz	MBB1A_RAT Myb-binding protein 1A OS=Rattus norvegicus OX=10116 GN=Mybbp1a PE=1 SV=2
16	AFDB:Q7TPV4	0.165	0.156	2.569E-6	1344	0.119	0.109	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
17	PDB:4a0cA	0.149	0.156	3.123E-6	1155	0.110	0.118	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:6tc0C	0.162	0.185	3.860E-6	994	0.103	0.128	6tc0C.pdb.gz
19	PDB:6yejA	0.149	0.106	5.494E-6	2046	0.101	0.061	6yejA.pdb.gz
20	PDB:6ez8A	0.155	0.102	6.328E-6	2353	0.095	0.050	6ez8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6W5U7	0.0	1154	1226	0.483	0.485	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
2	O18415	0.0	911	1116	0.392	0.433	O18415_DROME Nuclear protein SA OS=Drosophila melanogaster OX=7227 GN=SA1 PE=2 SV=1
3	O35638	0.0	2551	1231	0.991	0.991	STAG2_MOUSE Cohesin subunit SA-2 OS=Mus musculus OX=10090 GN=Stag2 PE=1 SV=3
4	O70576	0.0	1103	1240	0.456	0.452	STAG3_MOUSE Cohesin subunit SA-3 OS=Mus musculus OX=10090 GN=Stag3 PE=1 SV=2
5	Q19555	0.0	618	1096	0.293	0.329	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
6	Q68DW7	0.0	1397	998	0.566	0.698	Q68DW7_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
7	Q8N3U4	0.0	2571	1231	1.000	1.000	STAG2_HUMAN Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3
8	Q8WVM7	0.0	1789	1258	0.722	0.707	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
9	Q99M76	0.0	1087	1256	0.444	0.435	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
10	Q9D3E6	0.0	1776	1258	0.718	0.703	STAG1_MOUSE Cohesin subunit SA-1 OS=Mus musculus OX=10090 GN=Stag1 PE=1 SV=3
11	Q9DGN0	0.0	2172	1194	0.864	0.890	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
12	Q9DGN1	0.0	1731	1265	0.698	0.679	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
13	Q9UJ98	0.0	1154	1225	0.483	0.485	STAG3_HUMAN Cohesin subunit SA-3 OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=2
14	Q9VM62	0.0	912	1127	0.392	0.429	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
15	C9JJQ0	2.95e-96	309	232	0.128	0.677	C9JJQ0_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
16	O82265	1.03e-75	275	1098	0.206	0.231	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
17	Q9W0F4	1.34e-57	219	973	0.202	0.256	Q9W0F4_DROME Stromalin-2 OS=Drosophila melanogaster OX=7227 GN=SA2 PE=3 SV=3
18	Q3S4X5	1.40e-57	219	973	0.215	0.272	Q3S4X5_DROME SNM OS=Drosophila melanogaster OX=7227 GN=SA2 PE=2 SV=1
19	O13816	3.35e-35	148	962	0.081	0.104	SCC3_SCHPO Cohesin subunit psc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psc3 PE=1 SV=3
20	C9J3T3	9.27e-34	130	188	0.047	0.309	C9J3T3_HUMAN Stromal antigen 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00670 AdoHcyase_NAD	1.6e+02	13.8	S-adenosyl-L-homocysteine hydrolase, NAD binding domain
2	PF12719 Cnd3	48	14.6	Nuclear condensing complex subunits, C-term domain
3	PF00784 MyTH4	3e+02	13.2	MyTH4 domain
4	PF08514 STAG	3e-33	125.4	STAG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000001987

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000001441	0.999	Structural maintenance of chromosomes 3
2	9361.ENSDNOP00000003716	0.999	Structural maintenance of chromosomes 1A
3	9361.ENSDNOP00000024738	0.999	annotation not available
4	9361.ENSDNOP00000033073	0.999	annotation not available
5	9361.ENSDNOP00000017288	0.998	Structural maintenance of chromosomes 1B
6	9361.ENSDNOP00000015381	0.997	PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
7	9361.ENSDNOP00000004538	0.996	Stromal antigen 1
8	9361.ENSDNOP00000008482	0.996	Nipped-B homolog (Drosophila)
9	9361.ENSDNOP00000031250	0.995	RAD21-like 1 (S. pombe)
10	9361.ENSDNOP00000011912	0.994	PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
11	9361.ENSDNOP00000011132	0.993	REC8 meiotic recombination protein
12	9361.ENSDNOP00000010071	0.992	Extra spindle pole bodies homolog 1 (S. cerevisiae)
13	9361.ENSDNOP00000016845	0.988	Structural maintenance of chromosomes 5
14	9361.ENSDNOP00000028218	0.987	Structural maintenance of chromosomes 6
15	9361.ENSDNOP00000000602	0.985	Structural maintenance of chromosomes 2
16	9361.ENSDNOP00000025799	0.985	Wings apart-like homolog (Drosophila)
17	9361.ENSDNOP00000007213	0.983	annotation not available
18	9361.ENSDNOP00000026813	0.983	annotation not available
19	9361.ENSDNOP00000028966	0.981	Cell division cycle associated 5
20	9361.ENSDNOP00000013663	0.978	Polo-like kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.941	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006996	0.986	organelle organization
GO:0051276	0.969	chromosome organization
GO:0007059	0.967	chromosome segregation
GO:0098813	0.934	nuclear chromosome segregation
GO:0000280	0.933	nuclear division
GO:0044085	0.898	cellular component biogenesis
GO:0022607	0.894	cellular component assembly
GO:0000819	0.890	sister chromatid segregation
GO:1903047	0.856	mitotic cell cycle process
GO:0007017	0.843	microtubule-based process
GO:0140014	0.836	mitotic nuclear division
GO:0000070	0.813	mitotic sister chromatid segregation
GO:0007052	0.649	mitotic spindle organization
GO:0051225	0.586	spindle assembly
GO:0090307	0.580	mitotic spindle assembly
GO:0050789	0.387	regulation of biological process
GO:0050794	0.370	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000785	0.998	chromatin
GO:0032991	0.953	protein-containing complex
GO:0005737	0.816	cytoplasm
GO:0005829	0.790	cytosol
GO:0044815	0.624	DNA packaging complex
GO:0098687	0.587	chromosomal region
GO:0005819	0.549	spindle
GO:0000775	0.541	chromosome, centromeric region
GO:0016020	0.397	membrane
GO:0008278	0.327	cohesin complex
GO:0000922	0.309	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]