StarFunc result for job id Q8N3V7

User Input

>input (929 residues)
MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEG
VSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTAS
PSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQR
VNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGV
PGHSMEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQNREAQQSSPA
PPPAEVHSPAADVNQNLASPSATLTTPTSNSSHNPPATDVNQNPPATVVPQSLPLSSIQQ
NSSEAQLPSNGTGPASKPSTLCADGQPQAPAEEVRCSTLLIDKVSTPATTTSTFSREATL
IPSSRPPASDFMSSSLLIDIQPNTLVVSADQEMSGRAAATTPTKVYSEVHFTLAKPPSVV
NRTARPFGIQAPGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVE
RRMMGQRSPASERRPLGNFTAPPTYTETLSTAPLASWVRSPPSYSVLYPSSDPKSSHLKG
QAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGV
EEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEA
SGKGAELYARRQSRMEKYVIESSSHTPELARCPSPTMSLPSSWKYPTNAPGAFRVASRSP
ARTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL
DLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSP
RAKQAPRPSFSTRNAGIEAQVWKPSFCFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N3V7	1.000	1.000	0.000	929	1.000	1.000	Q8N3V7.pdb.gz	SYNPO_HUMAN Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2
2	AFDB:Q9Z327	0.323	0.323	4.567E-88	931	0.790	0.788	Q9Z327.pdb.gz	SYNPO_RAT Synaptopodin OS=Rattus norvegicus OX=10116 GN=Synpo PE=1 SV=2
3	AFDB:U3JAM7	0.052	0.044	1.891E-11	1184	0.259	0.204	U3JAM7.pdb.gz	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
4	AFDB:F1RCC9	0.068	0.055	3.187E-11	1179	0.233	0.183	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
5	AFDB:Q8BWB1	0.060	0.058	1.207E-8	975	0.257	0.245	Q8BWB1.pdb.gz	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
6	AFDB:Q9UMS6	0.058	0.051	4.976E-7	1093	0.219	0.186	Q9UMS6.pdb.gz	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
7	AFDB:D4A702	0.089	0.072	4.204E-5	1262	0.207	0.152	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
8	AFDB:Q69ZZ9	0.053	0.051	6.512E-4	979	0.151	0.143	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
9	AFDB:P48552	0.060	0.051	8.294E-3	1158	0.174	0.140	P48552.pdb.gz	NRIP1_HUMAN Nuclear receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=NRIP1 PE=1 SV=2
10	AFDB:P37370	0.045	0.048	1.937E-2	817	0.172	0.196	P37370.pdb.gz	VRP1_YEAST Verprolin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VRP1 PE=1 SV=2
11	PDB:7nacm	0.031	0.041	1.338	666	0.025	0.035	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:6elzm	0.031	0.042	2.113	645	0.031	0.045	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
13	PDB:3jb9M	0.035	0.111	6.002	207	0.028	0.126	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:6m5rC	0.033	0.230	7.792	105	0.012	0.105	6m5rC.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
15	PDB:5fywR	0.022	0.083	8.877	199	0.016	0.075	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
16	PDB:7nacw	0.033	0.042	8.877	672	0.023	0.031	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CC35	0.0	1385	929	0.794	0.794	SYNPO_MOUSE Synaptopodin OS=Mus musculus OX=10090 GN=Synpo PE=1 SV=2
2	Q8N3V7	0.0	1850	929	1.000	1.000	SYNPO_HUMAN Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2
3	Q9Z327	0.0	1391	931	0.797	0.795	SYNPO_RAT Synaptopodin OS=Rattus norvegicus OX=10116 GN=Synpo PE=1 SV=2
4	A7UMX5	1.25e-29	129	996	0.149	0.139	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
5	U3JAM7	1.55e-24	113	1184	0.101	0.079	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
6	A0A2R8RTS6	1.73e-24	112	879	0.100	0.106	A0A2R8RTS6_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
7	Q9UMS6	9.71e-16	84.7	1093	0.091	0.078	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
8	Q8BWB1	1.84e-15	83.6	975	0.127	0.121	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
9	B4DLE4	2.40e-15	82.8	698	0.091	0.122	B4DLE4_HUMAN cDNA FLJ54419, highly similar to Synaptopodin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
10	Q91YE8	1.56e-14	80.9	1087	0.094	0.080	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
11	D4A702	2.85e-14	80.1	1262	0.051	0.037	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
12	Q9H987	1.48e-13	77.4	977	0.095	0.090	SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3
13	H0Y9Y3	4.24e-13	76.3	1155	0.047	0.038	H0Y9Y3_HUMAN Synaptopodin 2 (Fragment) OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=1
14	A0A140LH61	1.60e-09	64.3	1151	0.072	0.058	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
15	F1RCC9	1.63e-09	64.3	1179	0.072	0.057	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05556 Calsarcin	0.00018	32.8	Calcineurin-binding protein (Calsarcin)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377789

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361930	0.969	14-3-3 protein beta/alpha
2	9606.ENSP00000385450	0.965	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
3	9606.ENSP00000427772	0.952	Protein KIBRA
4	9606.ENSP00000368190	0.950	Nephrin
5	9606.ENSP00000252699	0.907	Alpha-actinin-4
6	9606.ENSP00000349960	0.892	Actin, cytoplasmic 1
7	9606.ENSP00000356587	0.884	Podocin
8	9606.ENSP00000352264	0.848	CD2-associated protein
9	9606.ENSP00000367817	0.835	Podocalyxin
10	9606.ENSP00000458162	0.825	Actin, cytoplasmic 2
11	9606.ENSP00000331327	0.824	Wilms tumor protein
12	9606.ENSP00000270112	0.740	Hormonally up-regulated Neu-associated kinase
13	9606.ENSP00000302579	0.720	Sciellin
14	9606.ENSP00000264255	0.702	Thioredoxin domain-containing protein 9
15	9606.ENSP00000400175	0.688	Transforming protein RhoA
16	9606.ENSP00000281171	0.681	Receptor-type tyrosine-protein phosphatase O
17	9606.ENSP00000390590	0.672	Dendrin
18	9606.ENSP00000433102	0.668	Tripartite motif-containing protein 3
19	9606.ENSP00000260128	0.656	Extracellular sulfatase Sulf-1
20	9606.ENSP00000361499	0.646	Protein YIPF3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.878	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.970	biological regulation
GO:0016043	0.968	cellular component organization
GO:0050794	0.963	regulation of cellular process
GO:0032501	0.919	multicellular organismal process
GO:0050896	0.886	response to stimulus
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.847	positive regulation of cellular process
GO:0034330	0.806	cell junction organization
GO:0051128	0.733	regulation of cellular component organization
GO:0023051	0.663	regulation of signaling
GO:0010646	0.663	regulation of cell communication
GO:0050808	0.483	synapse organization
GO:0044087	0.345	regulation of cellular component biogenesis
GO:0048583	0.340	regulation of response to stimulus
GO:0032956	0.338	regulation of actin cytoskeleton organization
GO:0009966	0.333	regulation of signal transduction
GO:0048856	0.330	anatomical structure development
GO:1902903	0.319	regulation of supramolecular fiber organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043197	0.999	dendritic spine
GO:0012505	0.998	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0005856	0.996	cytoskeleton
GO:0005829	0.992	cytosol
GO:0015629	0.984	actin cytoskeleton
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005634	0.427	nucleus
GO:0031982	0.358	vesicle
GO:0098978	0.320	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]