StarFunc result for job id Q8N3X1

User Input

>input (1017 residues)
MGKKSRAVPGRRPILQLSPPGPRGSTPGRDPEPEPDTEPDSTAAVPSQPAPSAATTTTTA
VTAAAASDDSPSEDEQEAVQEVPRVVQNPPKPVMTTRPTAVKATGGLCLLGAYADSDDDD
NDVSEKLAQSKETNGNQSTDIDSTLANFLAEIDAITAPQPAAPVGASAPPPTPPRPEPKE
AATSTLSSSTSNGTDSTQTSGWQYDTQCSLAGVGIEMGDWQEVWDENTGCYYYWNTQTNE
VTWELPQYLATQVQGLQHYQPSSVPGAETSFVVNTDIYSKEKTISVSSSKSGPVIAKREV
KKEVNEGIQALSNSEEEKKGVAASLLAPLLPEGIKEEEERWRRKVICKEEPVSEVKETST
TVEEATTIVKPQEIMLDNIEDPSQEDLCSVVQSGESEEEEEQDTLELELVLERKKAELRA
LEEGDGSVSGSSPRSDISQPASQDGMRRLMSKRGKWKMFVRATSPESTSRSSSKTGRDTP
ENGETAIGAENSEKIDENSDKEMEVEESPEKIKVQTTPKVEEEQDLKFQIGELANTLTSK
FEFLGINRQSISNFHVLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKG
WSCHWDRDHRRYFYVNEQSGESQWEFPDGEEEEEESQAQENRDETLAKQTLKDKTGTDSN
STESSETSTGSLCKESFSGQVSSSSLMPLTPFWTLLQSNVPVLQPPLPLEMPPPPPPPPE
SPPPPPPPPPPAEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPSAQTTVVTSQSSVDSTI
SSSSSTKGIKRKATEISTAVVQRSATIGSSPVLYSQSAIATGHQAAGIGNQATGIGHQTI
PVSLPAAGMGHQARGMSLQSNYLGLAAAPAIMSYAECSVPIGVTAPSLQPVQARGAVPTA
TIIEPPPPPPPPPPPPPPAPKMPPPEKTKKGRKDKAKKSKTKMPSLVKKWQSIQRELDEE
DNSSSSEEDRESTAQKRIEEWKQQQLVSGMAERNANFEALPEDWRARLKRRKMAPNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N3X1	0.999	0.999	0.000	1017	1.000	1.000	Q8N3X1.pdb.gz	FNBP4_HUMAN Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3
2	AFDB:Q9VWC6	0.046	0.035	1.800E-3	1596	0.124	0.079	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
3	AFDB:F8VPQ2	0.075	0.065	3.392E-3	1261	0.136	0.109	F8VPQ2.pdb.gz	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
4	PDB:7kkfA	0.033	0.195	1.033E-2	162	0.011	0.068	7kkfA.pdb.gz
5	AFDB:Q9HC77	0.045	0.036	1.130E-2	1338	0.147	0.111	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
6	AFDB:Q9BX66	0.051	0.046	1.283E-2	1292	0.149	0.118	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
7	AFDB:A6H5Y1	0.041	0.042	2.129E-2	991	0.130	0.133	A6H5Y1.pdb.gz	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
8	AFDB:Q62417	0.048	0.042	2.417E-2	1290	0.144	0.113	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
9	AFDB:C3KGP2	0.052	0.060	3.113E-2	837	0.107	0.130	C3KGP2.pdb.gz	C3KGP2_DROME MIP04163p OS=Drosophila melanogaster OX=7227 GN=Mitf PE=2 SV=1
10	AFDB:Q9Y2W1	0.042	0.044	3.113E-2	955	0.129	0.137	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
11	AFDB:E9PFQ4	0.046	0.043	3.765E-2	1115	0.157	0.143	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
12	PDB:1yw5A	0.034	0.178	4.435E-2	177	0.011	0.062	1yw5A.pdb.gz
13	PDB:1nmvA	0.031	0.176	1.011E-1	163	0.013	0.080	1nmvA.pdb.gz
14	PDB:3ix0B	0.028	0.240	1.862	94	0.004	0.043	3ix0B.pdb.gz
15	PDB:2kc8A	0.034	0.257	2.723	95	0.010	0.105	2kc8A.pdb.gz
16	PDB:1k0rA	0.042	0.105	3.091	326	0.011	0.034	1k0rA.pdb.gz
17	PDB:4i6mA	0.024	0.056	3.293	399	0.015	0.038	4i6mA.pdb.gz
18	PDB:5izbA	0.037	0.193	3.508	89	0.014	0.157	5izbA.pdb.gz
19	PDB:6j6gA	0.034	0.020	3.508	1913	0.017	0.009	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
20	PDB:6o9lQ	0.035	0.069	3.508	430	0.025	0.058	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N3X1	0.0	2051	1017	1.000	1.000	FNBP4_HUMAN Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3
2	P28023	1.1	35.8	1280	0.026	0.020	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
3	Q8I492	2.9	34.3	1434	0.026	0.018	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
4	Q502P2	8.0	32.3	314	0.024	0.076	Q502P2_DANRE Homer protein homolog 2 OS=Danio rerio OX=7955 GN=zgc:111960 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17451 Glyco_hyd_101C	5.7e+02	12.2	Glycosyl hydrolase 101 beta sandwich domain
2	PF00397 WW	2.6e-16	70.7	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263773

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358242	0.838	Arginine/serine-rich protein PNISR
2	9606.ENSP00000359988	0.826	Serine/arginine-rich splicing factor 11
3	9606.ENSP00000413625	0.767	Formin-binding protein 1
4	9606.ENSP00000368801	0.741	WW domain-binding protein 4
5	9606.ENSP00000386458	0.710	Pre-mRNA-processing factor 40 homolog A
6	9606.ENSP00000351646	0.679	Stress-induced-phosphoprotein 1
7	9606.ENSP00000397351	0.655	Delphilin
8	9606.ENSP00000232978	0.576	NK-tumor recognition protein
9	9606.ENSP00000416951	0.573	Zinc finger CCCH-type containing 18
10	9606.ENSP00000283875	0.570	General transcription factor IIE subunit 1
11	9606.ENSP00000216832	0.568	Pinin
12	9606.ENSP00000427567	0.552	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly
13	9606.ENSP00000365172	0.518	KDEL motif-containing protein 1
14	9606.ENSP00000399259	0.508	FCH and double SH3 domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.995	metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0090304	0.981	nucleic acid metabolic process
GO:0016070	0.924	RNA metabolic process
GO:0065007	0.875	biological regulation
GO:0050789	0.874	regulation of biological process
GO:0006397	0.858	mRNA processing
GO:0050794	0.763	regulation of cellular process
GO:0019222	0.394	regulation of metabolic process
GO:0060255	0.375	regulation of macromolecule metabolic process
GO:0051171	0.371	regulation of nitrogen compound metabolic process
GO:0008380	0.329	RNA splicing
GO:0071840	0.317	cellular component organization or biogenesis
GO:0080090	0.314	regulation of primary metabolic process
GO:0031323	0.304	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0005737	0.467	cytoplasm
GO:0032991	0.323	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]