StarFunc result for job id Q8N3Y1

User Input

>input (598 residues)
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLL
EGAGRPPAARATRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLP
YELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLI
FQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTW
DYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDA
RIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVA
VAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLE
AGRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSA
VQMDDWKIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRN
ADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N3Y1	1.000	1.000	0.000	598	1.000	1.000	Q8N3Y1.pdb.gz	FBXW8_HUMAN F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=2
2	AFDB:Q8BIA4	0.791	0.791	1.117E-92	598	0.773	0.773	Q8BIA4.pdb.gz	FBXW8_MOUSE F-box/WD repeat-containing protein 8 OS=Mus musculus OX=10090 GN=Fbxw8 PE=1 SV=2
3	PDB:7z8bF	0.682	0.885	4.965E-77	457	0.758	0.991	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
4	AFDB:Q8VBV4	0.566	0.483	7.056E-29	710	0.182	0.154	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
5	AFDB:B8A474	0.574	0.461	1.214E-28	760	0.189	0.149	B8A474.pdb.gz
6	AFDB:Q93794	0.561	0.571	8.850E-27	587	0.181	0.184	Q93794.pdb.gz	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
7	AFDB:Q9VZF4	0.552	0.266	1.793E-26	1326	0.182	0.082	Q9VZF4.pdb.gz	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
8	AFDB:Q54R82	0.414	0.281	3.185E-25	942	0.159	0.101	Q54R82.pdb.gz	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
9	AFDB:A0A0S2Z507	0.481	0.456	4.411E-25	636	0.149	0.140	A0A0S2Z507.pdb.gz	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
10	AFDB:Q09855	0.432	0.494	6.450E-25	506	0.161	0.190	Q09855.pdb.gz	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
11	AFDB:A0A2R8QFQ6	0.479	0.505	9.959E-25	562	0.140	0.149	A0A2R8QFQ6.pdb.gz	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
12	PDB:6ttuT	0.461	0.660	3.964E-21	394	0.117	0.178	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
13	PDB:5mzhB	0.506	0.709	4.861E-18	415	0.119	0.171	5mzhB.pdb.gz
14	PDB:7mq8SG	0.382	0.556	6.584E-17	389	0.094	0.144	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7bt6x	0.466	0.563	8.637E-17	488	0.085	0.105	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:3jcmB	0.397	0.532	6.438E-16	429	0.117	0.163	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
17	PDB:7mq8LR	0.409	0.323	1.108E-15	773	0.099	0.076	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mqaLQ	0.262	0.197	1.620E-15	830	0.095	0.069	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:3dm0A	0.357	0.321	2.788E-15	675	0.099	0.087	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
20	PDB:5jpqY	0.389	0.593	2.944E-15	365	0.074	0.121	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FIY5	0.0	1028	494	0.823	0.996	A0A499FIY5_HUMAN F-box and WD repeat domain containing 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=1
2	P0DL28	0.0	948	596	0.774	0.777	FBXW8_RAT F-box/WD repeat-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Fbxw8 PE=1 SV=1
3	Q8BIA4	0.0	933	598	0.788	0.788	FBXW8_MOUSE F-box/WD repeat-containing protein 8 OS=Mus musculus OX=10090 GN=Fbxw8 PE=1 SV=2
4	Q8N3Y1	0.0	1238	598	1.000	1.000	FBXW8_HUMAN F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=2
5	Q8VBV4	2.72e-18	91.3	710	0.152	0.128	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
6	B7ZDC8	3.06e-18	90.5	544	0.151	0.165	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
7	Q969H0	1.56e-17	89.0	707	0.149	0.126	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
8	Q9VZF4	4.01e-13	75.1	1326	0.151	0.068	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
9	Q09855	2.64e-10	65.5	506	0.147	0.174	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
10	Q91854	3.53e-09	62.0	518	0.140	0.162	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1
11	Q9Y297	5.23e-09	61.6	605	0.142	0.140	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
12	A0A0S2Z507	5.25e-09	61.6	636	0.142	0.134	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
13	B7Z3H4	9.98e-09	60.5	579	0.142	0.147	B7Z3H4_HUMAN Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
14	Q3ULA2	2.40e-08	59.3	605	0.140	0.139	FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2
15	A0A0B4KHK1	3.36e-08	58.9	597	0.135	0.136	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
16	Q9VDE3	5.63e-08	58.2	510	0.135	0.159	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
17	Q4V8C4	1.79e-07	55.8	328	0.097	0.177	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
18	O44382	2.06e-07	56.2	510	0.132	0.155	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
19	Q9V3J8	3.47e-07	55.1	361	0.080	0.133	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
20	Q93794	5.58e-07	55.1	587	0.164	0.167	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	5.2	18.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00646 F-box	1.7e-05	35.8	F-box domain
3	PF12937 F-box-like	4.8e-10	50.5	F-box-like
4	PF11715 Nup160	3.8e+02	11.2	Nucleoporin Nup120/160
5	PF00400 WD40	0.0013	30.7	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
2	9606.ENSP00000438788	0.999	Cullin-7
3	9606.ENSP00000216225	0.998	E3 ubiquitin-protein ligase RBX1
4	9606.ENSP00000326804	0.978	Cullin-1
5	9606.ENSP00000359385	0.966	Glomulin
6	9606.ENSP00000385636	0.883	Obscurin-like protein 1
7	9606.ENSP00000303158	0.879	Coiled-coil domain-containing protein 8
8	9606.ENSP00000281623	0.829	F-box only protein 4
9	9606.ENSP00000229307	0.826	Homeobox protein NANOG
10	9606.ENSP00000250495	0.738	NEDD8
11	9606.ENSP00000349722	0.735	Ubiquitin conjugating enzyme E2 D3
12	9606.ENSP00000354340	0.728	NEDD8-activating enzyme E1 catalytic subunit
13	9606.ENSP00000304895	0.705	Insulin receptor substrate 1
14	9606.ENSP00000482345	0.701	annotation not available
15	9606.ENSP00000227507	0.680	G1/S-specific cyclin-D1
16	9606.ENSP00000364589	0.662	Cullin-4A
17	9606.ENSP00000274255	0.653	S-phase kinase-associated protein 2
18	9606.ENSP00000344866	0.650	F-box/LRR-repeat protein 5
19	9606.ENSP00000247977	0.633	F-box/LRR-repeat protein 12
20	9606.ENSP00000313869	0.633	Golgi reassembly-stacking protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.956	catalytic activity
GO:0140096	0.939	catalytic activity, acting on a protein
GO:0016740	0.918	transferase activity
GO:0019787	0.807	ubiquitin-like protein transferase activity
GO:0004842	0.796	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0010256	0.983	endomembrane system organization
GO:0036211	0.977	protein modification process
GO:0051239	0.962	regulation of multicellular organismal process
GO:0050793	0.960	regulation of developmental process
GO:0070647	0.959	protein modification by small protein conjugation or removal
GO:0006996	0.950	organelle organization
GO:0050773	0.948	regulation of dendrite development
GO:0032446	0.946	protein modification by small protein conjugation
GO:0048522	0.945	positive regulation of cellular process
GO:0010769	0.945	regulation of cell morphogenesis involved in differentiation
GO:0007030	0.944	Golgi organization
GO:0048814	0.943	regulation of dendrite morphogenesis
GO:0016567	0.941	protein ubiquitination
GO:0050775	0.927	positive regulation of dendrite morphogenesis
GO:0044237	0.681	cellular metabolic process
GO:0043632	0.519	modification-dependent macromolecule catabolic process
GO:0019941	0.492	modification-dependent protein catabolic process
GO:0019222	0.490	regulation of metabolic process
GO:0006511	0.484	ubiquitin-dependent protein catabolic process
GO:0060255	0.473	regulation of macromolecule metabolic process
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0080090	0.472	regulation of primary metabolic process
GO:0010604	0.447	positive regulation of macromolecule metabolic process
GO:0031323	0.424	regulation of cellular metabolic process
GO:0008283	0.374	cell population proliferation
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031461	0.996	cullin-RING ubiquitin ligase complex
GO:0005829	0.982	cytosol
GO:0012505	0.951	endomembrane system
GO:0070013	0.877	intracellular organelle lumen
GO:0005634	0.826	nucleus
GO:0048471	0.805	perinuclear region of cytoplasm
GO:0005794	0.802	Golgi apparatus
GO:0031981	0.753	nuclear lumen
GO:0019005	0.660	SCF ubiquitin ligase complex
GO:0005654	0.406	nucleoplasm
GO:0031467	0.373	Cul7-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.918	Transferases.

[back to server]