StarFunc result for job id Q8N423

User Input

>input (598 residues)
MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRL
YREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGA
YPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAI
FSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGES
LTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAH
NLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAG
AADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSG
PSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLF
LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQ
PEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N423	1.000	1.000	0.000	598	1.000	1.000	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
2	AFDB:Q8NHL6	0.681	0.629	3.339E-92	650	0.843	0.775	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
3	AFDB:O75019	0.661	0.804	4.922E-81	489	0.632	0.773	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
4	AFDB:O75023	0.709	0.718	7.542E-77	590	0.676	0.685	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
5	AFDB:Q8N6C8	0.688	0.930	8.849E-77	439	0.584	0.795	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
6	AFDB:O75022	0.635	0.603	1.941E-75	631	0.702	0.666	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
7	AFDB:P59901	0.537	0.628	8.528E-62	499	0.487	0.583	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
8	AFDB:P97484	0.591	0.429	2.317E-56	841	0.470	0.334	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
9	AFDB:P43630	0.425	0.545	8.921E-37	455	0.278	0.365	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
10	AFDB:P43629	0.435	0.574	1.104E-36	444	0.269	0.363	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	PDB:5oj2B	0.193	0.173	4.238E-11	692	0.134	0.116	5oj2B.pdb.gz
12	PDB:1e07A	0.155	0.146	2.094E-10	642	0.112	0.104	1e07A.pdb.gz
13	PDB:7q1yA	0.146	0.076	5.459E-10	1374	0.089	0.039	7q1yA.pdb.gz
14	PDB:7vonA	0.155	0.080	5.109E-9	1399	0.090	0.039	7vonA.pdb.gz
15	PDB:4rtdA	0.145	0.087	1.197E-8	1122	0.097	0.052	4rtdA.pdb.gz
16	PDB:1hzhH	0.148	0.177	1.405E-8	457	0.095	0.125	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
17	PDB:7q5zA	0.143	0.076	1.833E-8	1344	0.089	0.039	7q5zA.pdb.gz
18	PDB:5a42A	0.155	0.079	5.318E-8	1597	0.099	0.037	5a42A.pdb.gz
19	PDB:4lnvB	0.120	0.073	1.810E-7	1063	0.077	0.043	4lnvB.pdb.gz
20	PDB:4ziqA	0.132	0.065	4.718E-7	1450	0.092	0.038	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	720	489	0.607	0.742	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	721	631	0.699	0.662	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	O75023	0.0	721	590	0.677	0.686	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
4	P59901	0.0	525	499	0.465	0.557	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
5	Q8N149	0.0	660	483	0.567	0.702	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
6	Q8N423	0.0	1202	597	0.993	0.995	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
7	Q8N6C8	0.0	685	439	0.582	0.793	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
8	Q8NHL6	0.0	889	650	0.831	0.765	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
9	P97484	3.15e-153	463	841	0.475	0.338	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	4.18e-127	391	697	0.393	0.337	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	Q8NHJ6	5.61e-105	326	448	0.361	0.482	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
12	A6NI73	4.26e-73	238	299	0.211	0.421	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
13	Q8N743	1.20e-71	238	410	0.274	0.400	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	P43630	2.60e-71	238	455	0.303	0.398	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
15	P43629	4.53e-66	224	444	0.283	0.381	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
16	Q14943	9.83e-66	221	382	0.246	0.385	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
17	Q64281	4.85e-53	186	335	0.177	0.316	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	P43631	3.37e-52	183	304	0.209	0.411	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
19	Q61450	4.08e-51	180	303	0.162	0.320	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
20	P43628	1.40e-49	177	341	0.219	0.384	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14828 Amnionless	7.7e+02	10.2	Amnionless
2	PF19870 DUF6343	2.5e+02	13.4	Family of unknown function (DUF6343)
3	PF00047 ig	2.6e-14	64.5	Immunoglobulin domain
4	PF13895 Ig_2	1.1e-24	97.8	Immunoglobulin domain
5	PF13927 Ig_3	2.6e-21	87.3	Immunoglobulin domain
6	PF16680 Ig_4	4.2e+02	13.0	T-cell surface glycoprotein CD3 delta chain
7	PF06024 Orf78	6.7e+02	12.0	Orf78 (ac78)
8	PF02009 RIFIN	2.8e+02	12.8	Rifin
9	PF15330 SIT	45	16.0	SHP2-interacting transmembrane adaptor protein, SIT
10	PF07686 V-set	0.67	21.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412927	0.999	HLA class I histocompatibility antigen, alpha chain G
2	9606.ENSP00000452780	0.997	Beta-2-microglobulin
3	9606.ENSP00000399168	0.989	HLA class I histocompatibility antigen, B-7 alpha chain
4	9606.ENSP00000356946	0.968	Low affinity immunoglobulin gamma Fc region receptor III-A
5	9606.ENSP00000362524	0.968	Angiopoietin-related protein 2
6	9606.ENSP00000365402	0.962	HLA class I histocompatibility antigen, Cw-7 alpha chain
7	9606.ENSP00000259951	0.952	HLA class I histocompatibility antigen, alpha chain F
8	9606.ENSP00000379873	0.937	HLA class I histocompatibility antigen, A-3 alpha chain
9	9606.ENSP00000351497	0.931	Low affinity immunoglobulin gamma Fc region receptor II-b
10	9606.ENSP00000262629	0.930	TYRO protein tyrosine kinase-binding protein
11	9606.ENSP00000271450	0.917	Low affinity immunoglobulin gamma Fc region receptor II-a
12	9606.ENSP00000358165	0.905	High affinity immunoglobulin gamma Fc receptor I
13	9606.ENSP00000433642	0.904	Low affinity immunoglobulin gamma Fc region receptor III-B
14	9606.ENSP00000344218	0.900	Transmembrane protein C1orf162
15	9606.ENSP00000391592	0.899	Tyrosine-protein phosphatase non-receptor type 6
16	9606.ENSP00000365817	0.871	HLA class I histocompatibility antigen, alpha chain E
17	9606.ENSP00000286301	0.831	Macrophage colony-stimulating factor 1 receptor
18	9606.ENSP00000263863	0.828	Granulysin
19	9606.ENSP00000356505	0.815	Neutrophil cytosol factor 2
20	9606.ENSP00000260010	0.814	Toll-like receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.980	transmembrane signaling receptor activity
GO:0005102	0.850	signaling receptor binding
GO:0042287	0.822	MHC protein binding
GO:0140375	0.804	immune receptor activity
GO:0019903	0.804	protein phosphatase binding
GO:0042288	0.760	MHC class I protein binding
GO:0008157	0.723	protein phosphatase 1 binding
GO:0044877	0.711	protein-containing complex binding
GO:0023029	0.447	MHC class Ib protein binding
GO:0032393	0.435	MHC class I receptor activity
GO:0042802	0.308	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0051716	0.986	cellular response to stimulus
GO:0051239	0.979	regulation of multicellular organismal process
GO:0048519	0.976	negative regulation of biological process
GO:0002682	0.976	regulation of immune system process
GO:0006955	0.974	immune response
GO:0007166	0.969	cell surface receptor signaling pathway
GO:0032680	0.940	regulation of tumor necrosis factor production
GO:0050776	0.934	regulation of immune response
GO:0002683	0.934	negative regulation of immune system process
GO:0051241	0.931	negative regulation of multicellular organismal process
GO:0050865	0.931	regulation of cell activation
GO:0006952	0.930	defense response
GO:0048518	0.923	positive regulation of biological process
GO:0002768	0.919	immune response-regulating cell surface receptor signaling pathway
GO:0002694	0.899	regulation of leukocyte activation
GO:0051240	0.895	positive regulation of multicellular organismal process
GO:0051249	0.883	regulation of lymphocyte activation
GO:0048523	0.882	negative regulation of cellular process
GO:0048522	0.847	positive regulation of cellular process
GO:0048585	0.843	negative regulation of response to stimulus
GO:0060284	0.819	regulation of cell development
GO:1902105	0.806	regulation of leukocyte differentiation
GO:0002695	0.761	negative regulation of leukocyte activation
GO:0051250	0.704	negative regulation of lymphocyte activation
GO:0002684	0.683	positive regulation of immune system process
GO:0030155	0.627	regulation of cell adhesion
GO:1902106	0.596	negative regulation of leukocyte differentiation
GO:0045637	0.572	regulation of myeloid cell differentiation
GO:0002761	0.546	regulation of myeloid leukocyte differentiation
GO:0045670	0.514	regulation of osteoclast differentiation
GO:0009893	0.503	positive regulation of metabolic process
GO:0002762	0.502	negative regulation of myeloid leukocyte differentiation
GO:0010604	0.492	positive regulation of macromolecule metabolic process
GO:0032501	0.439	multicellular organismal process
GO:0009605	0.439	response to external stimulus
GO:0022407	0.435	regulation of cell-cell adhesion
GO:0009607	0.430	response to biotic stimulus
GO:0032879	0.426	regulation of localization
GO:0070663	0.416	regulation of leukocyte proliferation
GO:0050863	0.409	regulation of T cell activation
GO:0048584	0.405	positive regulation of response to stimulus
GO:1903037	0.404	regulation of leukocyte cell-cell adhesion
GO:0051707	0.375	response to other organism
GO:0051049	0.366	regulation of transport
GO:0051251	0.363	positive regulation of lymphocyte activation
GO:0042221	0.347	response to chemical
GO:0031347	0.325	regulation of defense response
GO:0032101	0.322	regulation of response to external stimulus
GO:0050670	0.307	regulation of lymphocyte proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.989	endomembrane system
GO:0043227	0.988	membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0031090	0.926	organelle membrane
GO:0031410	0.918	cytoplasmic vesicle
GO:0098588	0.899	bounding membrane of organelle
GO:0030659	0.885	cytoplasmic vesicle membrane
GO:0030141	0.829	secretory granule
GO:0009986	0.588	cell surface
GO:0030667	0.388	secretory granule membrane
GO:0005576	0.370	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]