StarFunc result for job id Q8N442

User Input

>input (669 residues)
MWTLVGRGWGCARALAPRATGAALLVAPGPRSAPTLGAAPESWATDRLYSSAEFKEKLDM
SRFPVENIRNFSIVAHVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKA
QTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVANFF
LAFEAQLSVIPVINKIDLKNADPERVENQIEKVFDIPSDECIKISAKLGTNVESVLQAII
ERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAHTQKTYEVNEV
GVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPVEPLPGFKSAKPMVFAG
MYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQE
YNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPDKSKVTEYLEPVVLGTIIT
PDEYTGKIMMLCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDFYDSLKSLSSGYASFD
YEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQ
AAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKKLRKIGNVEVPKDAFI
KVLKTQSSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C3X4	0.914	0.939	0.000	651	0.871	0.896	Q8C3X4.pdb.gz	GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus OX=10090 GN=Guf1 PE=1 SV=1
2	AFDB:Q9FNM5	0.871	0.856	4.230E-88	681	0.459	0.451	Q9FNM5.pdb.gz	GUFP_ARATH Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g08650 PE=1 SV=2
3	AFDB:O13869	0.879	0.902	2.147E-86	652	0.439	0.451	O13869.pdb.gz	GUF1_SCHPO Translation factor guf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=guf1 PE=3 SV=2
4	AFDB:P9WK97	0.873	0.894	2.944E-85	653	0.445	0.456	P9WK97.pdb.gz	LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lepA PE=1 SV=1
5	AFDB:P46943	0.854	0.884	2.189E-83	645	0.456	0.473	P46943.pdb.gz	GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUF1 PE=1 SV=2
6	AFDB:P60785	0.855	0.952	1.124E-82	599	0.425	0.474	P60785.pdb.gz	LEPA_ECOLI Elongation factor 4 OS=Escherichia coli (strain K12) OX=83333 GN=lepA PE=1 SV=1
7	AFDB:Q38BU9	0.846	0.740	1.448E-71	768	0.384	0.335	Q38BU9.pdb.gz	GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4600 PE=3 SV=1
8	PDB:3jcex	0.719	0.810	3.149E-64	586	0.420	0.480	3jcex.pdb.gz	EF4 disengages the peptidyl-tRNA CCA end and facilitates back-translocation on the 70S ribosome
9	AFDB:P25039	0.593	0.526	9.646E-42	761	0.212	0.187	P25039.pdb.gz	EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF1 PE=1 SV=2
10	AFDB:P13551	0.540	0.524	7.258E-41	691	0.196	0.190	P13551.pdb.gz	EFG_THETH Elongation factor G OS=Thermus thermophilus OX=274 GN=fusA PE=1 SV=1
11	AFDB:O30913	0.593	0.574	8.549E-41	693	0.200	0.193	O30913.pdb.gz	EFG1_BORBU Elongation factor G 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=fusA PE=3 SV=2
12	PDB:7pjvx	0.531	0.508	4.555E-35	703	0.205	0.195	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.
13	PDB:7nshBC	0.515	0.494	8.299E-35	700	0.203	0.194	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
14	PDB:7cdwA	0.448	0.441	2.876E-33	683	0.187	0.183	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.
15	PDB:6vlzv	0.518	0.490	8.627E-29	712	0.194	0.183	6vlzv.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
16	PDB:7dvqC	0.555	0.424	5.219E-28	902	0.160	0.119	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:6j6gC	0.562	0.421	2.155E-27	920	0.176	0.128	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:2bv3A	0.481	0.506	8.427E-27	632	0.178	0.188	2bv3A.pdb.gz	Crystal Structure of a Mutant Elongation Factor G Trapped with a GTP Analogue.
19	PDB:3jb9B	0.556	0.423	1.622E-26	904	0.166	0.123	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:5lj3C	0.558	0.433	1.809E-26	882	0.166	0.126	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O13869	0.0	613	652	0.433	0.445	GUF1_SCHPO Translation factor guf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=guf1 PE=3 SV=2
2	P46943	0.0	609	645	0.456	0.473	GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUF1 PE=1 SV=2
3	P60785	0.0	578	599	0.428	0.477	LEPA_ECOLI Elongation factor 4 OS=Escherichia coli (strain K12) OX=83333 GN=lepA PE=1 SV=1
4	P9WK97	0.0	617	653	0.435	0.446	LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lepA PE=1 SV=1
5	Q8C3X4	0.0	1195	651	0.874	0.899	GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus OX=10090 GN=Guf1 PE=1 SV=1
6	Q9FNM5	0.0	612	681	0.450	0.442	GUFP_ARATH Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g08650 PE=1 SV=2
7	Q38BU9	1.95e-141	433	768	0.390	0.340	GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4600 PE=3 SV=1
8	Q9HU67	3.28e-42	164	605	0.227	0.251	Q9HU67_PSEAE Large ribosomal subunit assembly factor BipA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=typA PE=3 SV=1
9	O06563	8.03e-38	151	628	0.215	0.229	O06563_MYCTU Large ribosomal subunit assembly factor BipA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=typA PE=1 SV=2
10	F4K409	3.46e-37	150	676	0.230	0.228	F4K409_ARATH Elongation factor family protein OS=Arabidopsis thaliana OX=3702 GN=SVR3 PE=1 SV=1
11	P0DTT0	6.25e-37	148	607	0.203	0.224	BIPA_ECOLI Large ribosomal subunit assembly factor BipA OS=Escherichia coli (strain K12) OX=83333 GN=bipA PE=1 SV=1
12	F4K410	8.20e-37	149	675	0.227	0.225	SVR3_ARATH Putative elongation factor TypA-like SVR3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SVR3 PE=1 SV=1
13	F4IPW5	8.06e-30	127	671	0.188	0.188	F4IPW5_ARATH Elongation factor family protein OS=Arabidopsis thaliana OX=3702 GN=EMB2785 PE=1 SV=1
14	O74945	3.52e-27	120	1000	0.100	0.067	RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ria1 PE=3 SV=1
15	Q7Z2Z2	6.35e-27	119	1120	0.094	0.056	EFL1_HUMAN Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2
16	P15112	2.65e-25	114	839	0.087	0.069	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
17	Q5A0M4	3.29e-25	113	842	0.091	0.072	EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EFT2 PE=1 SV=2
18	Q6FYA7	9.66e-25	112	842	0.090	0.071	EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EFT1 PE=3 SV=1
19	P32324	1.40e-24	111	842	0.091	0.072	EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFT1 PE=1 SV=1
20	Q8I592	1.59e-24	111	803	0.091	0.076	Q8I592_PLAF7 Elongation factor G, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1233000 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00679 EFG_C	2.9e-18	77.0	Elongation factor G C-terminus
2	PF14492 EFG_III	0.24	22.8	Elongation Factor G, domain III
3	PF00009 GTP_EFTU	1.1e-50	183.5	Elongation factor Tu GTP binding domain
4	PF03144 GTP_EFTU_D2	3.7e-07	41.7	Elongation factor Tu domain 2
5	PF06421 LepA_C	1.5e-43	158.6	GTP-binding protein LepA C-terminus
6	PF01926 MMR_HSR1	0.0084	27.6	50S ribosome-binding GTPase
7	PF16897 MMR_HSR1_Xtn	70	14.9	C-terminal region of MMR_HSR1 domain
8	PF00071 Ras	0.0022	29.1	Ras family
9	PF16658 RF3_C	0.0073	27.5	Class II release factor RF3, C-terminal domain
10	PF08477 Roc	4.1e+02	12.6	Ras of Complex, Roc, domain of DAPkinase
11	PF09439 SRPRB	0.57	21.1	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479860	0.904	Calcium and integrin binding 1
2	9606.ENSP00000341082	0.849	Mitochondrial ribosomal protein L20
3	9606.ENSP00000258455	0.842	Mitochondrial ribosomal protein S9
4	9606.ENSP00000288937	0.833	Mitochondrial ribosomal protein L17
5	9606.ENSP00000377486	0.820	Mitochondrial ribosomal protein L19
6	9606.ENSP00000359859	0.816	Mitochondrial ribosome-associated GTPase 2
7	9606.ENSP00000226193	0.814	Recoverin
8	9606.ENSP00000245539	0.814	Mitochondrial ribosomal protein S7
9	9606.ENSP00000278572	0.809	40S ribosomal protein S3
10	9606.ENSP00000306548	0.801	Mitochondrial ribosomal protein L13
11	9606.ENSP00000362036	0.800	Mitochondrial ribosomal protein S16
12	9606.ENSP00000400467	0.796	L ribosomal proteins
13	9606.ENSP00000363676	0.788	60S ribosomal protein L11
14	9606.ENSP00000225969	0.787	Mitochondrial ribosomal protein L27
15	9606.ENSP00000384952	0.785	Mitochondrial ribosomal protein S12
16	9606.ENSP00000420311	0.783	Ribosomal protein L23
17	9606.ENSP00000354580	0.782	Mitochondrial ribosomal protein L21
18	9606.ENSP00000377784	0.778	Guanylyl cyclase-activating protein 1
19	9606.ENSP00000317376	0.771	Mitochondrial ribosomal protein S11
20	9606.ENSP00000259469	0.770	60S ribosomal protein L35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	0.997	GTPase activity
GO:0043021	0.996	ribonucleoprotein complex binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.939	RNA binding
GO:0036094	0.825	small molecule binding
GO:0019001	0.820	guanyl nucleotide binding
GO:0032561	0.813	guanyl ribonucleotide binding
GO:0043168	0.800	anion binding
GO:0003729	0.497	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0065007	0.920	biological regulation
GO:0044237	0.916	cellular metabolic process
GO:0006807	0.904	nitrogen compound metabolic process
GO:0043170	0.846	macromolecule metabolic process
GO:0019222	0.810	regulation of metabolic process
GO:0034641	0.766	cellular nitrogen compound metabolic process
GO:1901564	0.691	organonitrogen compound metabolic process
GO:1901576	0.634	organic substance biosynthetic process
GO:0044249	0.618	cellular biosynthetic process
GO:0050794	0.585	regulation of cellular process
GO:0010467	0.568	gene expression
GO:0019538	0.524	protein metabolic process
GO:0006412	0.507	translation
GO:0051171	0.401	regulation of nitrogen compound metabolic process
GO:0046483	0.360	heterocycle metabolic process
GO:0006725	0.359	cellular aromatic compound metabolic process
GO:1901360	0.328	organic cyclic compound metabolic process
GO:0006139	0.320	nucleobase-containing compound metabolic process
GO:0071840	0.315	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.948	intracellular organelle lumen
GO:0016020	0.764	membrane
GO:0005759	0.709	mitochondrial matrix
GO:0032991	0.446	protein-containing complex
GO:0005634	0.424	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.997	GTP + H2O = GDP + H(+) + phosphate

[back to server]