StarFunc result for job id Q8N461

User Input

>input (479 residues)
MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSL
AAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQV
CKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLD
ICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSL
SARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLR
LLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRIT
DMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5MJ12	0.884	0.884	1.080E-90	479	0.967	0.967	Q5MJ12.pdb.gz	FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus OX=10116 GN=Fbxl16 PE=2 SV=1
2	AFDB:Q6TGX5	0.622	0.716	3.091E-25	411	0.194	0.226	Q6TGX5.pdb.gz	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
3	AFDB:Q8BH16	0.598	0.667	3.476E-25	423	0.219	0.248	Q8BH16.pdb.gz	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
4	AFDB:Q5BJ29	0.472	0.462	5.888E-25	491	0.232	0.226	Q5BJ29.pdb.gz	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
5	AFDB:Q96IG2	0.619	0.672	1.261E-24	436	0.219	0.241	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
6	AFDB:P34284	0.612	0.628	4.575E-24	466	0.192	0.197	P34284.pdb.gz	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
7	PDB:6o60C	0.621	0.747	3.917E-23	389	0.221	0.272	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
8	AFDB:Q8CDU4	0.420	0.292	4.238E-23	790	0.169	0.103	Q8CDU4.pdb.gz	FXL13_MOUSE F-box and leucine-rich repeat protein 13 OS=Mus musculus OX=10090 GN=Fbxl13 PE=1 SV=2
9	AFDB:A0A1D8PP13	0.474	0.309	4.679E-22	780	0.198	0.122	A0A1D8PP13.pdb.gz	A0A1D8PP13_CANAL SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GRR1 PE=4 SV=1
10	AFDB:Q8NEE6	0.359	0.254	1.127E-21	735	0.196	0.128	Q8NEE6.pdb.gz	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
11	AFDB:Q9UF56	0.476	0.342	5.478E-21	701	0.213	0.146	Q9UF56.pdb.gz	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
12	PDB:3oglB	0.392	0.347	3.828E-12	568	0.138	0.116	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
13	PDB:2p1nB	0.395	0.349	5.131E-12	571	0.169	0.142	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:4i6jB	0.380	0.442	1.862E-11	394	0.138	0.168	4i6jB.pdb.gz
15	PDB:7b5mT	0.382	0.535	3.546E-11	325	0.148	0.218	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:1a4yA	0.516	0.535	4.482E-11	460	0.171	0.178	1a4yA.pdb.gz
17	PDB:7pmkL	0.425	0.427	7.458E-10	475	0.157	0.158	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7sa1B	0.315	0.261	1.340E-9	624	0.171	0.131	7sa1B.pdb.gz
19	PDB:4kxfP	0.515	0.307	5.465E-9	866	0.159	0.088	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
20	PDB:7pzcA	0.390	0.203	1.983E-8	1010	0.129	0.061	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5MJ12	0.0	942	479	0.967	0.967	FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus OX=10116 GN=Fbxl16 PE=2 SV=1
2	Q8N461	0.0	972	479	1.000	1.000	FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens OX=9606 GN=FBXL16 PE=2 SV=2
3	Q9CZV8	8.47e-29	120	436	0.234	0.257	FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus OX=10090 GN=Fbxl20 PE=1 SV=3
4	Q5RH13	1.53e-28	119	400	0.240	0.287	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
5	Q96IG2	2.41e-28	119	436	0.232	0.255	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
6	Q8N1E6	5.52e-28	117	418	0.225	0.258	FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens OX=9606 GN=FBXL14 PE=1 SV=1
7	Q6TGX5	1.95e-27	115	411	0.225	0.263	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
8	A8DYA6	2.29e-26	114	651	0.207	0.152	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
9	A1Z8M8	2.97e-26	113	464	0.207	0.213	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
10	A8DYA5	3.10e-26	112	426	0.207	0.232	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
11	Q5BI22	3.64e-26	112	437	0.207	0.227	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
12	A0A0B4KEK4	4.60e-26	112	455	0.207	0.218	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
13	A0A0B4KEU4	4.63e-26	112	497	0.207	0.199	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
14	Q5BJ29	2.44e-23	104	491	0.269	0.263	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
15	Q9UJT9	3.01e-23	104	491	0.267	0.261	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
16	Q9UKC9	7.33e-20	94.0	423	0.167	0.189	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3
17	Q8BH16	3.04e-19	92.0	423	0.163	0.184	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
18	Q9VF10	5.93e-19	92.4	772	0.236	0.146	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
19	P34284	1.77e-17	87.0	466	0.188	0.193	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
20	Q9SKK0	3.25e-17	86.7	628	0.169	0.129	EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana OX=3702 GN=EBF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11448 DUF3005	4.3e+02	12.3	Protein of unknown function (DUF3005)
2	PF00646 F-box	76	14.6	F-box domain
3	PF12937 F-box-like	16	16.8	F-box-like
4	PF00560 LRR_1	1.2e-05	35.9	Leucine Rich Repeat
5	PF12799 LRR_4	5.8e-06	37.8	Leucine Rich repeats (2 copies)
6	PF13516 LRR_6	3.8e-10	50.0	Leucine Rich repeat
7	PF13855 LRR_8	0.91	20.7	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326804	0.905	Cullin-1
2	9606.ENSP00000231487	0.869	S-phase kinase-associated protein 1
3	9606.ENSP00000216225	0.700	E3 ubiquitin-protein ligase RBX1
4	9606.ENSP00000320318	0.694	Sialidase-4
5	9606.ENSP00000327694	0.694	AP-2 complex subunit alpha-2
6	9606.ENSP00000352035	0.693	Potassium voltage-gated channel subfamily KQT member 2
7	9606.ENSP00000325074	0.685	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
8	9606.ENSP00000415491	0.682	Phytanoyl-CoA hydroxylase-interacting protein
9	9606.ENSP00000430945	0.672	Adhesion G protein-coupled receptor B1
10	9606.ENSP00000264051	0.670	Ephexin-1
11	9606.ENSP00000250495	0.669	NEDD8
12	9606.ENSP00000287878	0.661	5'-AMP-activated protein kinase subunit gamma-2
13	9606.ENSP00000323856	0.635	Plectin
14	9606.ENSP00000469689	0.629	SH3 and multiple ankyrin repeat domains protein 2
15	9606.ENSP00000414786	0.609	Transmembrane protein 64
16	9606.ENSP00000396103	0.603	Myelin transcription factor 1-like protein
17	9606.ENSP00000316338	0.592	Brain-specific angiogenesis inhibitor 1-associated protein 2
18	9606.ENSP00000159111	0.588	Lysine-specific demethylase 4B
19	9606.ENSP00000355827	0.579	F-box only protein 28
20	9606.ENSP00000371805	0.567	F-box/LRR-repeat protein 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0044238	0.984	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:1901564	0.942	organonitrogen compound metabolic process
GO:0019538	0.920	protein metabolic process
GO:0044237	0.875	cellular metabolic process
GO:0009057	0.837	macromolecule catabolic process
GO:0006508	0.827	proteolysis
GO:0065007	0.819	biological regulation
GO:0050789	0.753	regulation of biological process
GO:0030163	0.716	protein catabolic process
GO:0051603	0.604	proteolysis involved in protein catabolic process
GO:0044260	0.598	cellular macromolecule metabolic process
GO:0044265	0.594	cellular macromolecule catabolic process
GO:0019941	0.582	modification-dependent protein catabolic process
GO:0050794	0.444	regulation of cellular process
GO:0006511	0.301	ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.988	cytosol
GO:0016020	0.405	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]