StarFunc result for job id Q8N465

User Input

>input (521 residues)
MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVRRLPFS
TVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCH
ERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRY
VEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLT
SLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCK
GMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNAGHDAEKLGHFLEH
ALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVYKYDLSLPVERLYDIVTDLRA
RLGPHAKHVVGYGHLGDGNLHLNVTAEAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGF
RKRDVLGYSKPPGALQLMQQLKALLDPKGILNPYKTLPSQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N465	1.000	1.000	0.000	521	1.000	1.000	Q8N465.pdb.gz	D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=D2HGDH PE=1 SV=3
2	PDB:6lpnB	0.894	0.998	1.347E-101	467	0.896	1.000	6lpnB.pdb.gz	Structure, substrate specificity, and catalytic mechanism of human D-2-HGDH and insights into pathogenicity of disease-associated mutations.
3	AFDB:P84850	0.949	0.924	1.157E-99	535	0.804	0.783	P84850.pdb.gz	D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=D2hgdh PE=1 SV=1
4	AFDB:O23240	0.893	0.833	4.368E-77	559	0.526	0.490	O23240.pdb.gz	D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=D2HGDH PE=1 SV=3
5	AFDB:Q7K511	0.923	0.903	1.716E-75	533	0.480	0.469	Q7K511.pdb.gz	Q7K511_DROME CG3835-RA OS=Drosophila melanogaster OX=7227 GN=D2hgdh PE=1 SV=1
6	AFDB:P46681	0.905	0.890	3.585E-71	530	0.501	0.492	P46681.pdb.gz	DLD2_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD2 PE=1 SV=1
7	AFDB:Q9C1X2	0.921	0.913	3.205E-70	526	0.463	0.458	Q9C1X2.pdb.gz	YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.03 PE=3 SV=1
8	AFDB:P39976	0.892	0.936	6.270E-67	496	0.432	0.454	P39976.pdb.gz	DLD3_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD3 PE=1 SV=1
9	AFDB:Q9I6H4	0.825	0.923	1.006E-48	464	0.294	0.330	Q9I6H4.pdb.gz	Q9I6H4_PSEAE FAD-binding PCMH-type domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0317 PE=4 SV=1
10	AFDB:Q94AX4	0.841	0.776	2.116E-43	567	0.255	0.235	Q94AX4.pdb.gz	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
11	AFDB:Q11061	0.790	0.898	2.413E-41	455	0.257	0.295	Q11061.pdb.gz	Q11061_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1257c PE=1 SV=1
12	PDB:5adzA	0.726	0.672	8.537E-27	566	0.192	0.177	5adzA.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
13	PDB:1f0xA	0.711	0.737	1.843E-26	502	0.163	0.169	1f0xA.pdb.gz	The crystal structure of D-lactate dehydrogenase, a peripheral membrane respiratory enzyme.
14	PDB:5adzC	0.736	0.692	3.535E-26	557	0.190	0.178	5adzC.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
15	PDB:2uuuA	0.667	0.636	1.749E-25	550	0.173	0.164	2uuuA.pdb.gz	The Crucial Step in Ether Phospholipid Biosynthesis: Structural Basis of a Noncanonical Reaction Associated with a Peroxisomal Disorder.
16	PDB:2exrA	0.634	0.668	1.595E-21	491	0.150	0.159	2exrA.pdb.gz	Crystal structure of Arabidopsis thaliana cytokinin dehydrogenase.
17	PDB:6hfwA	0.578	0.691	2.578E-20	429	0.119	0.145	6hfwA.pdb.gz	Novel insight into the reaction of nitro, nitroso and hydroxylamino benzothiazinones and of benzoxacinones with Mycobacterium tuberculosis DprE1.
18	PDB:4pfdB	0.565	0.704	8.424E-20	410	0.117	0.149	4pfdB.pdb.gz	Crystal structure of M. tuberculosis in complex with a cBT
19	PDB:4p8tA	0.593	0.669	4.167E-19	456	0.121	0.138	4p8tA.pdb.gz	2-Carboxyquinoxalines Kill Mycobacterium tuberculosis through Noncovalent Inhibition of DprE1.
20	PDB:3w8wB	0.633	0.705	1.626E-18	461	0.167	0.189	3w8wB.pdb.gz	Flavin-mediated dual oxidation controls an enzymatic Favorskii-type rearrangement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O23240	0.0	549	559	0.528	0.492	D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=D2HGDH PE=1 SV=3
2	P84850	0.0	860	535	0.814	0.793	D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=D2hgdh PE=1 SV=1
3	Q8N465	0.0	1063	521	1.000	1.000	D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=D2HGDH PE=1 SV=3
4	P46681	3.23e-177	511	530	0.497	0.489	DLD2_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD2 PE=1 SV=1
5	Q7K511	4.13e-170	493	533	0.468	0.458	Q7K511_DROME CG3835-RA OS=Drosophila melanogaster OX=7227 GN=D2hgdh PE=1 SV=1
6	Q9C1X2	2.34e-158	462	526	0.453	0.449	YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.03 PE=3 SV=1
7	P39976	2.08e-152	446	496	0.440	0.462	DLD3_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD3 PE=1 SV=1
8	Q9I6H4	1.84e-87	278	464	0.299	0.336	Q9I6H4_PSEAE FAD-binding PCMH-type domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0317 PE=4 SV=1
9	F1QXM5	1.88e-44	166	497	0.246	0.258	LDHD_DANRE Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
10	P32891	8.41e-44	165	587	0.234	0.208	DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
11	Q11061	2.42e-42	159	455	0.276	0.316	Q11061_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1257c PE=1 SV=1
12	P0AEP9	4.96e-41	156	499	0.259	0.271	GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) OX=83333 GN=glcD PE=1 SV=1
13	O29853	5.08e-41	155	443	0.250	0.293	DLD_ARCFU D-lactate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=dld PE=1 SV=1
14	Q94AX4	6.11e-41	157	567	0.236	0.217	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
15	A0A0G2K1W9	1.95e-40	154	484	0.242	0.260	A0A0G2K1W9_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=3 SV=2
16	Q7TNG8	5.84e-40	153	484	0.236	0.254	LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1
17	Q86WU2	7.08e-40	153	507	0.246	0.252	LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1
18	P9WIT1	1.29e-38	149	459	0.248	0.281	Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1
19	A0A8I5Y6D8	5.37e-33	133	466	0.225	0.251	A0A8I5Y6D8_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
20	Q7TPJ4	1.27e-28	121	501	0.215	0.224	Q7TPJ4_RAT Ac2-202 OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02913 FAD-oxidase_C	4.6e-56	201.8	FAD linked oxidases, C-terminal domain
2	PF01565 FAD_binding_4	7.1e-31	118.3	FAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377668	0.953	Sulfite oxidase, mitochondrial
2	9606.ENSP00000331897	0.946	Isocitrate dehydrogenase [NADP], mitochondrial
3	9606.ENSP00000267436	0.944	L-2-hydroxyglutarate dehydrogenase, mitochondrial
4	9606.ENSP00000390265	0.868	Isocitrate dehydrogenase 1, cytosolic
5	9606.ENSP00000216442	0.796	V-type proton ATPase subunit D
6	9606.ENSP00000313953	0.788	Tetratricopeptide repeat domain containing
7	9606.ENSP00000234038	0.732	Protein phosphatase 1 regulatory subunit 7
8	9606.ENSP00000263918	0.728	Striatin
9	9606.ENSP00000350071	0.728	Striatin-3
10	9606.ENSP00000426638	0.721	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
11	9606.ENSP00000420091	0.679	SLIT and NTRK-like protein 3
12	9606.ENSP00000416959	0.674	Transformer-2 protein homolog beta
13	9606.ENSP00000263578	0.665	FAD-dependent oxidoreductase domain-containing protein 1
14	9606.ENSP00000346173	0.635	Electron transfer flavoprotein subunit beta
15	9606.ENSP00000375777	0.633	Striatin-4
16	9606.ENSP00000296350	0.611	Melanotransferrin
17	9606.ENSP00000302805	0.600	Protein DDI1 homolog 1
18	9606.ENSP00000215882	0.584	Tricarboxylate transport protein, mitochondrial
19	9606.ENSP00000379865	0.580	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
20	9606.ENSP00000355510	0.565	WD repeat-containing protein 64

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016614	1.000	oxidoreductase activity, acting on CH-OH group of donors
GO:0043169	0.997	cation binding
GO:0051990	0.986	(R)-2-hydroxyglutarate dehydrogenase activity
GO:0046872	0.904	metal ion binding
GO:0046914	0.868	transition metal ion binding
GO:0005515	0.852	protein binding
GO:0008270	0.852	zinc ion binding
GO:0097159	0.494	organic cyclic compound binding
GO:1901363	0.492	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0019752	0.899	carboxylic acid metabolic process
GO:0043648	0.782	dicarboxylic acid metabolic process
GO:0044238	0.621	primary metabolic process
GO:0006807	0.398	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.956	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	1.000	Acting on the CH-OH group of donors.
RHEA:38295	0.986	(R)-2-hydroxyglutarate + A = 2-oxoglutarate + AH2
EC:1.1.99.39	0.986	D-2-hydroxyglutarate dehydrogenase.

[back to server]