StarFunc result for job id Q8N474

User Input

>input (314 residues)
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C4U3	0.909	0.909	6.945E-57	314	0.949	0.949	Q8C4U3.pdb.gz	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
2	AFDB:F1QJG6	0.643	0.650	8.054E-40	310	0.631	0.639	F1QJG6.pdb.gz
3	AFDB:A0A0B5JK22	0.773	0.817	5.515E-39	296	0.570	0.605	A0A0B5JK22.pdb.gz
4	AFDB:Q8AWG4	0.711	0.709	4.631E-37	315	0.564	0.562	Q8AWG4.pdb.gz	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
5	AFDB:Q5T4F7	0.725	0.719	1.143E-35	317	0.564	0.558	Q5T4F7.pdb.gz	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
6	AFDB:Q7ZXM6	0.404	0.423	2.994E-30	298	0.408	0.430	Q7ZXM6.pdb.gz	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
7	AFDB:Q9IA96	0.423	0.453	7.391E-29	292	0.369	0.397	Q9IA96.pdb.gz	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
8	AFDB:B1WBV2	0.411	0.435	1.878E-28	295	0.373	0.397	B1WBV2.pdb.gz	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
9	AFDB:Q9I897	0.437	0.463	4.777E-24	295	0.350	0.373	Q9I897.pdb.gz	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
10	AFDB:Q9GUF5	0.402	0.402	9.073E-22	314	0.296	0.296	Q9GUF5.pdb.gz	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
11	PDB:1ueaB	0.210	0.342	1.090E-2	181	0.054	0.094	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	PDB:1u5kA	0.184	0.234	2.465E-2	242	0.041	0.054	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
13	PDB:2pi2A	0.183	0.362	4.047E-1	129	0.041	0.101	2pi2A.pdb.gz
14	PDB:4j15A	0.141	0.105	4.290E-1	431	0.041	0.030	4j15A.pdb.gz
15	PDB:3mxnB	0.152	0.273	6.086E-1	131	0.041	0.099	3mxnB.pdb.gz
16	PDB:3q8dB	0.178	0.233	6.451E-1	232	0.019	0.026	3q8dB.pdb.gz	Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
17	PDB:6hv92	0.121	0.073	7.684E-1	549	0.032	0.018	6hv92.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
18	PDB:3wxmB	0.073	0.066	9.153E-1	357	0.038	0.034	3wxmB.pdb.gz	Structural basis for mRNA surveillance by archaeal Pelota and GTP-bound EF1 alpha complex
19	PDB:6zxgj	0.165	0.364	1.028	116	0.013	0.034	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
20	PDB:1zeqX	0.140	0.444	1.090	84	0.025	0.095	1zeqX.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O19116	0.0	526	308	0.882	0.899	SFRP1_BOVIN Secreted frizzled-related protein 1 OS=Bos taurus OX=9913 GN=SFRP1 PE=2 SV=1
2	Q8C4U3	0.0	558	314	0.949	0.949	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
3	Q8N474	0.0	651	314	1.000	1.000	SFRP1_HUMAN Secreted frizzled-related protein 1 OS=Homo sapiens OX=9606 GN=SFRP1 PE=1 SV=1
4	Q6YNR8	2.90e-144	410	310	0.650	0.658	Q6YNR8_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=frp1 PE=2 SV=1
5	Q7T2K9	4.71e-122	353	296	0.586	0.622	Q7T2K9_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=Srfp1a PE=2 SV=1
6	Q8AWG4	4.48e-117	342	315	0.564	0.562	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
7	Q9XSC1	1.28e-114	335	315	0.529	0.527	SFRP5_BOVIN Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1
8	Q9WU66	6.85e-113	331	314	0.525	0.525	SFRP5_MOUSE Secreted frizzled-related protein 5 OS=Mus musculus OX=10090 GN=Sfrp5 PE=2 SV=1
9	Q9R168	1.77e-110	319	158	0.490	0.975	SFRP1_RAT Secreted frizzled-related protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Sfrp1 PE=2 SV=1
10	Q5T4F7	2.20e-108	320	317	0.525	0.521	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
11	Q7ZXM6	8.43e-78	241	298	0.392	0.413	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
12	Q863H1	3.47e-72	226	294	0.357	0.381	SFRP2_CANLF Secreted frizzled-related protein 2 OS=Canis lupus familiaris OX=9615 GN=SFRP2 PE=2 SV=1
13	Q9IA96	5.25e-72	226	292	0.357	0.384	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
14	Q96HF1	1.49e-71	225	295	0.357	0.380	SFRP2_HUMAN Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2
15	P97299	5.84e-71	223	295	0.354	0.376	SFRP2_MOUSE Secreted frizzled-related protein 2 OS=Mus musculus OX=10090 GN=Sfrp2 PE=1 SV=2
16	B1WBV2	2.41e-70	222	295	0.354	0.376	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
17	Q9I897	2.58e-58	191	295	0.350	0.373	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
18	Q9GUF5	7.96e-48	164	314	0.306	0.306	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
19	Q7SX78	8.80e-37	135	282	0.261	0.291	Q7SX78_DANRE Sizzled OS=Danio rerio OX=7955 GN=sfrp PE=2 SV=1
20	Q90ZT3	9.21e-24	103	559	0.166	0.093	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04475 DUF555	4.5e+02	12.6	Protein of unknown function (DUF555)
2	PF01392 Fz	2.6e-23	94.2	Fz domain
3	PF01759 NTR	2.1e-12	58.1	UNC-6/NTR/C345C module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293549	0.991	Proto-oncogene Wnt-1
2	9606.ENSP00000340677	0.977	Protein Wnt-8b
3	9606.ENSP00000294304	0.975	Low-density lipoprotein receptor-related protein 5
4	9606.ENSP00000426653	0.970	Protein Wnt-8a
5	9606.ENSP00000261349	0.965	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000265441	0.960	Protein Wnt-2
7	9606.ENSP00000284523	0.949	Protein Wnt-3a
8	9606.ENSP00000264634	0.937	Protein Wnt-5a
9	9606.ENSP00000323901	0.934	Frizzled-2
10	9606.ENSP00000287934	0.923	Frizzled-1
11	9606.ENSP00000290167	0.919	Protein Wnt-4
12	9606.ENSP00000358698	0.884	Protein Wnt-2b
13	9606.ENSP00000380379	0.882	Protein Wnt-5b
14	9606.ENSP00000225512	0.879	Proto-oncogene Wnt-3
15	9606.ENSP00000301061	0.879	Protein Wnt-10b
16	9606.ENSP00000285018	0.876	Protein Wnt-7a
17	9606.ENSP00000325526	0.876	Protein Wnt-11
18	9606.ENSP00000341032	0.874	Protein Wnt-7b
19	9606.ENSP00000222462	0.872	Protein Wnt-16
20	9606.ENSP00000233948	0.868	Protein Wnt-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.860	signaling receptor binding
GO:0005109	0.812	frizzled binding
GO:0017147	0.763	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.995	response to stimulus
GO:0048519	0.995	negative regulation of biological process
GO:0048522	0.995	positive regulation of cellular process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0051716	0.993	cellular response to stimulus
GO:0050793	0.992	regulation of developmental process
GO:0048523	0.992	negative regulation of cellular process
GO:0007154	0.988	cell communication
GO:0010941	0.985	regulation of cell death
GO:0051239	0.984	regulation of multicellular organismal process
GO:0045595	0.984	regulation of cell differentiation
GO:0007275	0.980	multicellular organism development
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0042127	0.968	regulation of cell population proliferation
GO:0048585	0.968	negative regulation of response to stimulus
GO:0007165	0.965	signal transduction
GO:0030178	0.957	negative regulation of Wnt signaling pathway
GO:0048731	0.952	system development
GO:0090090	0.952	negative regulation of canonical Wnt signaling pathway
GO:0045596	0.943	negative regulation of cell differentiation
GO:0042981	0.938	regulation of apoptotic process
GO:0016055	0.936	Wnt signaling pathway
GO:0045597	0.928	positive regulation of cell differentiation
GO:0048584	0.917	positive regulation of response to stimulus
GO:0051241	0.915	negative regulation of multicellular organismal process
GO:0019219	0.911	regulation of nucleobase-containing compound metabolic process
GO:0001932	0.910	regulation of protein phosphorylation
GO:0060548	0.909	negative regulation of cell death
GO:0023056	0.907	positive regulation of signaling
GO:0010647	0.907	positive regulation of cell communication
GO:0040008	0.904	regulation of growth
GO:0051128	0.898	regulation of cellular component organization
GO:0001558	0.879	regulation of cell growth
GO:0009967	0.879	positive regulation of signal transduction
GO:0048513	0.875	animal organ development
GO:0009653	0.874	anatomical structure morphogenesis
GO:0051252	0.874	regulation of RNA metabolic process
GO:0051173	0.870	positive regulation of nitrogen compound metabolic process
GO:0009888	0.869	tissue development
GO:0060429	0.864	epithelium development
GO:0060070	0.862	canonical Wnt signaling pathway
GO:0051248	0.858	negative regulation of protein metabolic process
GO:0030154	0.851	cell differentiation
GO:0010721	0.819	negative regulation of cell development
GO:0045936	0.819	negative regulation of phosphate metabolic process
GO:2000026	0.817	regulation of multicellular organismal development
GO:0009891	0.817	positive regulation of biosynthetic process
GO:0031400	0.816	negative regulation of protein modification process
GO:0010556	0.809	regulation of macromolecule biosynthetic process
GO:0042326	0.809	negative regulation of phosphorylation
GO:0031326	0.807	regulation of cellular biosynthetic process
GO:0009887	0.803	animal organ morphogenesis
GO:0010468	0.799	regulation of gene expression
GO:0010604	0.798	positive regulation of macromolecule metabolic process
GO:0009719	0.795	response to endogenous stimulus
GO:0043069	0.794	negative regulation of programmed cell death
GO:0008285	0.792	negative regulation of cell population proliferation
GO:0010717	0.788	regulation of epithelial to mesenchymal transition
GO:2001141	0.787	regulation of RNA biosynthetic process
GO:0001933	0.786	negative regulation of protein phosphorylation
GO:1901700	0.779	response to oxygen-containing compound
GO:0045598	0.774	regulation of fat cell differentiation
GO:0031325	0.765	positive regulation of cellular metabolic process
GO:0043066	0.763	negative regulation of apoptotic process
GO:0006355	0.757	regulation of DNA-templated transcription
GO:0007399	0.756	nervous system development
GO:0044092	0.744	negative regulation of molecular function
GO:0048729	0.685	tissue morphogenesis
GO:0010557	0.681	positive regulation of macromolecule biosynthetic process
GO:0002009	0.680	morphogenesis of an epithelium
GO:0050790	0.671	regulation of catalytic activity
GO:1902531	0.659	regulation of intracellular signal transduction
GO:0030177	0.649	positive regulation of Wnt signaling pathway
GO:1903706	0.646	regulation of hemopoiesis
GO:0048598	0.638	embryonic morphogenesis
GO:0030278	0.633	regulation of ossification
GO:0009605	0.630	response to external stimulus
GO:0035295	0.619	tube development
GO:0048646	0.615	anatomical structure formation involved in morphogenesis
GO:1902105	0.609	regulation of leukocyte differentiation
GO:0070887	0.591	cellular response to chemical stimulus
GO:0048468	0.590	cell development
GO:0010033	0.588	response to organic substance
GO:2001233	0.572	regulation of apoptotic signaling pathway
GO:0045935	0.567	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.561	positive regulation of RNA metabolic process
GO:0031328	0.553	positive regulation of cellular biosynthetic process
GO:0002683	0.550	negative regulation of immune system process
GO:0045893	0.543	positive regulation of DNA-templated transcription
GO:1903707	0.537	negative regulation of hemopoiesis
GO:0022603	0.536	regulation of anatomical structure morphogenesis
GO:0035239	0.517	tube morphogenesis
GO:0010942	0.515	positive regulation of cell death
GO:2000050	0.515	regulation of non-canonical Wnt signaling pathway
GO:0016331	0.514	morphogenesis of embryonic epithelium
GO:1902106	0.511	negative regulation of leukocyte differentiation
GO:0071840	0.478	cellular component organization or biogenesis
GO:0044093	0.445	positive regulation of molecular function
GO:0030279	0.386	negative regulation of ossification
GO:1902532	0.375	negative regulation of intracellular signal transduction
GO:0072175	0.366	epithelial tube formation
GO:0012501	0.333	programmed cell death
GO:0006357	0.304	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.979	cell periphery
GO:0016020	0.945	membrane
GO:0005886	0.916	plasma membrane
GO:0005622	0.906	intracellular anatomical structure
GO:0043226	0.894	organelle
GO:0043227	0.837	membrane-bounded organelle
GO:0005737	0.781	cytoplasm
GO:0043231	0.550	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]