StarFunc result for job id Q8N490

User Input

>input (385 residues)
MAAVVAATALKGRGARNARVLRGILAGATANKASHNRTRALQSHSSPEGKEEPEPLSPEL
EYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVK
VLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGG
NRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG
EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF
AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP
TGDDDYSRAQLLEELRRLKDMHKSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R415	0.878	0.878	1.305E-69	385	1.000	1.000	A0A024R415.pdb.gz
2	AFDB:Q16775	0.672	0.836	4.925E-31	308	0.299	0.373	Q16775.pdb.gz	GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2
3	AFDB:Q5ZI23	0.672	0.831	9.122E-31	310	0.268	0.332	Q5ZI23.pdb.gz	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
4	AFDB:Q8IPU3	0.675	0.745	2.501E-30	348	0.296	0.328	Q8IPU3.pdb.gz	Q8IPU3_DROME Tenzing norgay, isoform C OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
5	AFDB:O35952	0.668	0.829	5.183E-30	309	0.278	0.346	O35952.pdb.gz	GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hagh PE=1 SV=2
6	AFDB:C0H490	0.628	0.912	7.636E-29	263	0.249	0.365	C0H490.pdb.gz	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
7	AFDB:O24496	0.649	0.963	1.980E-28	258	0.275	0.411	O24496.pdb.gz	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
8	AFDB:Q8LDW8	0.630	0.730	5.108E-27	331	0.273	0.317	Q8LDW8.pdb.gz	GLO2D_ARATH Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLX2-4 PE=2 SV=1
9	AFDB:Q9SID3	0.617	0.730	6.760E-27	324	0.255	0.302	Q9SID3.pdb.gz	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
10	AFDB:O24495	0.633	0.734	8.418E-26	331	0.260	0.302	O24495.pdb.gz	GLO2M_ARATH Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLX2-1 PE=2 SV=2
11	PDB:6rz0A	0.614	0.932	2.584E-24	251	0.221	0.339	6rz0A.pdb.gz	Crystal structure of Escherichia coli Glyoxalase II
12	PDB:4chlB	0.451	0.714	2.327E-14	237	0.171	0.278	4chlB.pdb.gz	Crystal structure of human persulfide dioxygenase: structural basis of ethylmalonic encephalopathy.
13	PDB:4ad9A	0.376	0.491	3.591E-11	288	0.140	0.188	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
14	PDB:4uwpB	0.377	0.593	2.147E-9	230	0.106	0.178	4uwpB.pdb.gz	Structural and Biochemical Characterization of Vim-26 Show that Leu224 Has Implications for the Substrate Specificity of Vim Metallo-Beta-Lactamases.
15	PDB:2q0jA	0.376	0.458	6.587E-9	310	0.148	0.184	2q0jA.pdb.gz	Structure elucidation and preliminary assessment of hydrolase activity of PqsE, the Pseudomonas quinolone signal (PQS) response protein.
16	PDB:5evdA	0.383	0.536	7.368E-9	267	0.122	0.176	5evdA.pdb.gz	Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
17	PDB:1hlkA	0.393	0.635	9.751E-9	227	0.106	0.181	1hlkA.pdb.gz	Identification of a series of tricyclic natural products as potent broad spectrum inhibitors of metallo-beta-lactamases
18	PDB:6jkaC	0.382	0.610	1.708E-8	228	0.104	0.175	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
19	PDB:2m5cA	0.349	0.559	1.519E-7	227	0.104	0.176	2m5cA.pdb.gz	Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid.
20	PDB:4hl2A	0.353	0.528	2.976E-7	243	0.091	0.144	4hl2A.pdb.gz	New Delhi Metallo-beta-Lactamase-1 1.05 A structure Complexed with Hydrolyzed Ampicillin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69ZP3	0.0	761	385	0.961	0.961	PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus OX=10090 GN=Pnkd PE=1 SV=2
2	Q8N490	0.0	795	385	1.000	1.000	PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD PE=1 SV=2
3	Q9VPB3	1.47e-62	204	305	0.299	0.377	Q9VPB3_DROME LD26447p OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=2
4	Q9I7P8	1.10e-60	199	271	0.270	0.384	Q9I7P8_DROME Tenzing norgay, isoform B OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
5	Q8IPU3	3.96e-60	199	348	0.283	0.313	Q8IPU3_DROME Tenzing norgay, isoform C OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
6	O35952	1.13e-59	197	309	0.265	0.330	GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hagh PE=1 SV=2
7	Q99KB8	1.89e-59	197	309	0.268	0.333	GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hagh PE=1 SV=2
8	Q16775	4.38e-59	196	308	0.265	0.331	GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2
9	C0H490	4.76e-58	191	263	0.247	0.361	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
10	O24496	6.37e-58	191	258	0.268	0.399	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
11	Q5ZI23	1.10e-57	192	310	0.252	0.313	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
12	Q8LDW8	2.55e-44	158	331	0.247	0.287	GLO2D_ARATH Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLX2-4 PE=2 SV=1
13	Q6PII5	1.60e-43	154	290	0.226	0.300	HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens OX=9606 GN=HAGHL PE=1 SV=1
14	Q9SID3	1.33e-39	145	324	0.231	0.275	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
15	O24495	1.14e-38	143	331	0.255	0.296	GLO2M_ARATH Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLX2-1 PE=2 SV=2
16	O94250	1.81e-38	140	256	0.242	0.363	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
17	Q9UT36	4.03e-38	139	256	0.216	0.324	GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC824.07 PE=3 SV=1
18	Q8I5Y8	2.04e-32	126	322	0.174	0.208	Q8I5Y8_PLAF7 Targeted glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1205700 PE=3 SV=1
19	Q05584	7.57e-32	123	274	0.210	0.296	GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO2 PE=1 SV=1
20	Q585D9	1.37e-29	117	296	0.239	0.311	Q585D9_TRYB2 Hydroxyacylglutathione hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.500 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16123 HAGH_C	1e-16	72.4	Hydroxyacylglutathione hydrolase C-terminus
2	PF00753 Lactamase_B	6.9e-07	41.0	Metallo-beta-lactamase superfamily
3	PF12706 Lactamase_B_2	0.86	20.6	Beta-lactamase superfamily domain
4	PF13483 Lactamase_B_3	1.5e+02	13.7	Beta-lactamase superfamily domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326627	0.905	Acid-sensing ion channel 4
2	9606.ENSP00000362381	0.702	Torsin-2A
3	9606.ENSP00000456226	0.686	Interferon induced transmembrane protein domain containing
4	9606.ENSP00000470539	0.683	Protein PET100 homolog, mitochondrial
5	9606.ENSP00000347358	0.681	Melanoma-associated antigen 11
6	9606.ENSP00000254250	0.668	THAP domain-containing protein 1
7	9606.ENSP00000398930	0.661	Epsilon-sarcoglycan
8	9606.ENSP00000373399	0.656	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
9	9606.ENSP00000341364	0.642	Transmembrane protein 230
10	9606.ENSP00000444688	0.642	Sodium/potassium-transporting ATPase subunit alpha-3
11	9606.ENSP00000352962	0.626	Lipid phosphate phosphatase-related protein type 3
12	9606.ENSP00000349456	0.622	Chloride channel CLIC-like protein 1
13	9606.ENSP00000378328	0.619	Ankyrin repeat domain-containing protein 13B
14	9606.ENSP00000295569	0.618	Protein FAM19A4
15	9606.ENSP00000315635	0.614	In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.
16	9606.ENSP00000419045	0.614	GTP cyclohydrolase 1
17	9606.ENSP00000350928	0.612	Glutamate decarboxylase 1
18	9606.ENSP00000375859	0.607	Interferon induced transmembrane protein domain containing
19	9606.ENSP00000439244	0.594	Cip1-interacting zinc finger protein
20	9606.ENSP00000345719	0.587	Torsin-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.983	catalytic activity
GO:0016787	0.971	hydrolase activity
GO:0004416	0.919	hydroxyacylglutathione hydrolase activity
GO:0043167	0.338	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0046928	0.975	regulation of neurotransmitter secretion
GO:0048519	0.956	negative regulation of biological process
GO:0048523	0.921	negative regulation of cellular process
GO:0051051	0.916	negative regulation of transport
GO:1903531	0.885	negative regulation of secretion by cell
GO:0009987	0.777	cellular process
GO:0071704	0.430	organic substance metabolic process
GO:0044237	0.378	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.932	membrane
GO:0005829	0.379	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.971	Hydrolases.
RHEA:25245	0.919	(R)-S-lactoylglutathione + H2O = (R)-lactate + glutathione + H(+)
EC:3.1.2.6	0.919	hydroxyacylglutathione hydrolase.

[back to server]