StarFunc result for job id Q8N4C6

User Input

>input (2090 residues)
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLG
RVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEF
PEVTVIEPLDEEARPSHIPAGDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQ
DWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVE
DFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMTSTIGFRVFSCLDD
GMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENELLVTKNSIHQA
ALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR
KLDEEYKERIAALKNELRKEREQILQQAGKQRLELEQEIEKAKTEENYIRDRLALSLKEN
SRLENELLENAEKLAEYENLTNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEY
ERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNP
LNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHEN
ETHTLEKQISDLKNEIAELQGQAAVLKEAHHEATCRHEEEKKQLQVKLEEEKTHLQEKLR
LQHEMELKARLTQAQASFEREREGLQSSAWTEEKVRGLTQELEQFHQEQLTSLVEKHTLE
KEELRKELLEKHQRELQEGREKMETECNRRTSQIEAQFQSDCQKVTERCESALQSLEGRY
RQELKDLQEQQREEKSQWEFEKDELTQECAEAQELLKETLKREKTTSLVLTQEREMLEKT
YKEHLNSMVVERQQLLQDLEDLRNVSETQQSLLSDQILELKSSHKRELREREEVLCQAGA
SEQLASQRLERLEMEHDQERQEMMSKLLAMENIHKATCETADRERAEMSTEISRLQSKIK
EMQQATSPLSMLQSGCQVIGEEEVEGDGALSLLQQGEQLLEENGDVLLSLQRAHEQAVKE
NVKMATEISRLQQRLQKLEPGLVMSSCLDEPATEFFGNTAEQTEQFLQQNRTKQVEGVTR
RHVLSDLEDDEVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETRTESWELKNQI
SQLQEQLMMLCADCDRASEKKQDLLFDVSVLKKKLKMLERIPEASPKYKLLYEDVSREND
CLQEELRMMETRYDEALENNKELTAEVFRLQDELKKMEEVTETFLSLEKSYDEVKIENEG
LNVLVLRLQGKIEKLQESVVQRCDCCLWEASLENLEIEPDGNILQLNQTLEECVPRVRSV
HHVIEECKQENQYLEGNTQLLEKVKAHEIAWLHGTIQTHQERPRVQNQVILEENTTLLGF
QDKHFQHQATIAELELEKTKLQELTRKLKERVTILVKQKDVLSHGEKEEELKAMMHDLQI
TCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLGTLNGSQEEMWQKTET
VKQENAAVQKMVENLKKQISELKIKNQQLDLENTELSQKNSQNQEKLQELNQRLTEMLCQ
KEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAELSEVKIQTHIVQQENHLLK
DELEKMKQLHRCPDLSDFQQKISSVLSYNEKLLKEKEALSEELNSCVDKLAKSSLLEHRI
ATMKQEQKSWEHQSASLKSQLVASQEKVQNLEDTVQNVNLQMSRMKSDLRVTQQEKEALK
QEVMSLHKQLQNAGGKSWAPEIATHPSGLHNQQKRLSWDKLDHLMNEEQQLLWQENERLQ
TMVQNTKAELTHSREKVRQLESNLLPKHQKHLNPSGTMNPTEQEKLSLKRECDQFQKEQS
PANRKVSQMNSLEQELETIHLENEGLKKKQVKLDEQLMEMQHLRSTATPSPSPHAWDLQL
LQQQACPMVPREQFLQLQRQLLQAERINQHLQEELENRTSETNTPQGNQEQLVTVMEERM
IEVEQKLKLVKRLLQEKVNQLKEQVSLPGHLCSPTSHSSFNSSFTSLYCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61043	0.164	0.162	0.000	2113	0.769	0.761	Q61043.pdb.gz	NIN_MOUSE Ninein OS=Mus musculus OX=10090 GN=Nin PE=1 SV=4
2	AFDB:Q8N4C6	1.000	1.000	0.000	2090	1.000	1.000	Q8N4C6.pdb.gz	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
3	AFDB:I3ISQ9	0.149	0.158	2.609E-45	1954	0.291	0.312	I3ISQ9.pdb.gz
4	AFDB:A0A0G2LAC3	0.140	0.200	1.952E-33	1303	0.189	0.302	A0A0G2LAC3.pdb.gz
5	AFDB:Q9Y2I6	0.148	0.207	2.690E-33	1382	0.187	0.282	Q9Y2I6.pdb.gz	NINL_HUMAN Ninein-like protein OS=Homo sapiens OX=9606 GN=NINL PE=1 SV=2
6	AFDB:P11929	0.086	0.197	3.054E-11	820	0.076	0.193	P11929.pdb.gz	BSG2_DROME Blastoderm-specific protein 25D OS=Drosophila melanogaster OX=7227 GN=Bsg25D PE=1 SV=3
7	AFDB:Q58G59	0.049	0.066	1.644E-6	1363	0.076	0.117	Q58G59.pdb.gz	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
8	AFDB:Q86VH2	0.053	0.075	5.014E-5	1401	0.065	0.097	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
9	AFDB:Q57W72	0.042	0.099	7.287E-5	737	0.041	0.117	Q57W72.pdb.gz	Q57W72_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.420 PE=4 SV=1
10	AFDB:A0A0R4IHT4	0.060	0.085	1.623E-4	1396	0.064	0.096	A0A0R4IHT4.pdb.gz
11	PDB:5d43A	0.030	0.347	5.647E-3	150	0.013	0.187	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
12	PDB:7n6g3I	0.054	0.255	2.388E-2	401	0.021	0.110	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
13	PDB:3fwbA	0.033	0.338	2.802E-2	153	0.015	0.209	3fwbA.pdb.gz
14	PDB:1v1fA	0.030	0.239	5.043E-2	188	0.015	0.165	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
15	PDB:5a2hA	0.031	0.329	6.243E-2	147	0.015	0.218	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
16	PDB:2ct9B	0.029	0.222	6.947E-2	198	0.015	0.157	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
17	PDB:4uslA	0.034	0.348	8.601E-2	173	0.007	0.081	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
18	PDB:7eebI	0.032	0.315	8.601E-2	174	0.007	0.086	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
19	PDB:5x9aB	0.031	0.228	9.571E-2	198	0.013	0.141	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
20	PDB:3qrxA	0.033	0.363	1.010E-1	145	0.014	0.207	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J066	0.0	4073	2046	0.969	0.990	C9J066_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
2	E9PN67	0.0	3929	1989	0.937	0.985	E9PN67_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
3	H9KV85	0.0	3137	1581	0.756	0.999	H9KV85_HUMAN Ninein (Fragment) OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
4	Q61043	0.0	3108	2113	0.770	0.761	NIN_MOUSE Ninein OS=Mus musculus OX=10090 GN=Nin PE=1 SV=4
5	Q8N4C6	0.0	4201	2090	1.000	1.000	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
6	F1QE08	4.26e-174	572	1379	0.168	0.255	F1QE08_DANRE Ninein (GSK3B-interacting protein) OS=Danio rerio OX=7955 GN=nin PE=4 SV=2
7	Q9Y2I6	1.10e-117	410	1382	0.131	0.198	NINL_HUMAN Ninein-like protein OS=Homo sapiens OX=9606 GN=NINL PE=1 SV=2
8	G9G127	9.72e-115	400	1303	0.144	0.230	NINL_DANRE Ninein-like protein OS=Danio rerio OX=7955 GN=Ninl PE=1 SV=1
9	P11929	3.78e-08	61.2	820	0.026	0.067	BSG2_DROME Blastoderm-specific protein 25D OS=Drosophila melanogaster OX=7227 GN=Bsg25D PE=1 SV=3
10	O75145	0.016	42.7	1194	0.017	0.030	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
11	P60469	0.018	42.7	1194	0.017	0.030	LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=Ppfia3 PE=1 SV=2
12	Q91Z79	0.019	42.7	1192	0.017	0.030	LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 GN=Ppfia3 PE=1 SV=2
13	Q57U93	0.66	37.4	577	0.018	0.064	Q57U93_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.590 PE=4 SV=1
14	Q8TD31	0.66	37.4	782	0.020	0.054	CCHCR_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=2
15	A2ABH1	0.68	37.4	729	0.020	0.058	A2ABH1_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=1
16	X1WCJ5	0.73	37.4	1226	0.025	0.042	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
17	A0A1U9X7G6	0.80	37.4	835	0.020	0.050	A0A1U9X7G6_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
18	B9EKI3	1.2	36.6	1091	0.011	0.020	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
19	G3V9Y1	1.5	36.6	1986	0.022	0.024	G3V9Y1_RAT Myosin heavy chain 10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=2
20	Q61879	1.7	36.2	1976	0.022	0.024	MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08647 BRE1	5.3	18.5	BRE1 E3 ubiquitin ligase
2	PF00036 EF-hand_1	24	15.8	EF hand
3	PF13405 EF-hand_6	0.22	22.5	EF-hand domain
4	PF13499 EF-hand_7	0.48	22.2	EF-hand domain pair
5	PF01166 TSC22	1.6	20.3	TSC-22/dip/bun family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000466690	0.989	Coiled-coil domain-containing protein 68
2	9606.ENSP00000355500	0.976	Centrosomal protein of 170 kDa
3	9606.ENSP00000362962	0.956	Centriolin
4	9606.ENSP00000474071	0.954	Coiled-coil domain-containing protein 120
5	9606.ENSP00000403453	0.943	Outer dense fiber protein 2
6	9606.ENSP00000261700	0.934	RNA transcription, translation and transport factor protein
7	9606.ENSP00000278935	0.920	Centrosomal protein of 164 kDa
8	9606.ENSP00000451162	0.904	Centrosomal protein 128
9	9606.ENSP00000354791	0.896	Dynactin subunit 1
10	9606.ENSP00000352572	0.883	Pericentrin
11	9606.ENSP00000327077	0.840	Pericentriolar material 1 protein
12	9606.ENSP00000306105	0.833	Centrosomal protein of 89 kDa
13	9606.ENSP00000385000	0.825	Kinesin-like protein KIF2A
14	9606.ENSP00000324292	0.821	Fas-binding factor 1
15	9606.ENSP00000281142	0.818	Sodium channel and clathrin linker 1
16	9606.ENSP00000380911	0.815	Centrosomal protein of 83 kDa
17	9606.ENSP00000324806	0.813	Glycogen synthase kinase-3 beta
18	9606.ENSP00000318195	0.792	Nucleolin
19	9606.ENSP00000370021	0.748	Centlein
20	9606.ENSP00000370803	0.742	Centriolar coiled-coil protein of 110 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.665	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006996	0.991	organelle organization
GO:0007017	0.985	microtubule-based process
GO:0000226	0.979	microtubule cytoskeleton organization
GO:0031023	0.973	microtubule organizing center organization
GO:0007098	0.962	centrosome cycle
GO:0034453	0.950	microtubule anchoring
GO:0008104	0.948	protein localization
GO:0051642	0.792	centrosome localization
GO:0050794	0.725	regulation of cellular process
GO:0044085	0.416	cellular component biogenesis
GO:0022607	0.403	cellular component assembly
GO:0048518	0.339	positive regulation of biological process
GO:0048522	0.326	positive regulation of cellular process
GO:0051128	0.320	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0005654	0.999	nucleoplasm
GO:0005730	0.992	nucleolus
GO:0032991	0.943	protein-containing complex
GO:0005829	0.879	cytosol
GO:0120025	0.836	plasma membrane bounded cell projection
GO:0005819	0.761	spindle
GO:0005929	0.758	cilium
GO:0140535	0.756	intracellular protein-containing complex
GO:0005814	0.739	centriole
GO:0000922	0.605	spindle pole
GO:0072686	0.547	mitotic spindle
GO:0120103	0.390	centriolar subdistal appendage

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]