StarFunc result for job id Q8N4C8

User Input

>input (1332 residues)
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQ
QQQQQQQLQKQQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKS
KPGSTGPEPPIPQASPGPPGPLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQ
SLQDQPTRNLAAFPASHDPDPAIPAPTATPSARGAVIRQNSDPTSEGPGPSPNPPAWVRP
DNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSNSAWQIYLQRRAERGTPKPPG
PPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVGVSSKPDSSPV
LSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLH
ADSNGYTNLPDVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIY
QPGGSGDSIPITALVGGEGTRLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNS
EILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRN
KLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYRVVKYERIKFLVIALKSSVEV
YAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDI
YIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVY
FMTLNRNCIMNW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K490	0.446	0.438	0.000	1360	0.658	0.645	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
2	AFDB:A0A0G2K7W4	0.462	0.457	0.000	1348	0.645	0.637	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
3	AFDB:A0A0R4IEP9	0.287	0.287	0.000	1332	0.637	0.637	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
4	AFDB:F1LP90	0.284	0.284	0.000	1336	0.967	0.964	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
5	AFDB:F1M754	0.349	0.387	0.000	1178	0.578	0.654	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
6	AFDB:M9PBJ7	0.310	0.335	0.000	1213	0.474	0.521	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
7	AFDB:O95819	0.438	0.467	0.000	1239	0.621	0.667	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
8	AFDB:P83510	0.299	0.301	0.000	1323	0.659	0.664	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
9	AFDB:Q7KV88	0.289	0.341	0.000	1102	0.480	0.580	Q7KV88.pdb.gz	Q7KV88_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
10	AFDB:Q9JM52	0.256	0.260	0.000	1308	0.947	0.965	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
11	PDB:3eqdA	0.192	0.761	3.392E-20	315	0.068	0.289	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:4eomC	0.175	0.788	5.442E-17	276	0.056	0.268	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:5eymA	0.168	0.709	5.442E-17	292	0.060	0.274	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:1blxA	0.175	0.681	7.097E-17	305	0.055	0.239	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
15	PDB:4krcA	0.173	0.726	7.892E-17	297	0.061	0.273	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4yc3A	0.174	0.733	1.029E-16	295	0.059	0.264	4yc3A.pdb.gz
17	PDB:8a8mB	0.184	0.766	1.144E-16	298	0.071	0.315	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
18	PDB:4ek6A	0.166	0.731	2.282E-16	279	0.055	0.262	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
19	PDB:1unlA	0.171	0.722	2.407E-16	292	0.053	0.243	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:5u6yA	0.174	0.482	4.316E-16	459	0.058	0.168	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K490	1531	1360	0.668	0.654	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
2	A0A0G2K7W4	783	1379	0.378	0.365	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
3	A0A0R4IEP9	1459	1332	0.651	0.651	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
4	A0A8I5ZL09	1280	1321	0.600	0.605	A0A8I5ZL09_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
5	A0A8I5ZLV4	779	1382	0.378	0.365	A0A8I5ZLV4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
6	A0A8I5ZQ07	1533	1340	0.664	0.660	A0A8I5ZQ07_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
7	A0A8I5ZV95	1452	1305	0.647	0.661	A0A8I5ZV95_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
8	A0A8I5ZYP2	741	1325	0.329	0.331	A0A8I5ZYP2_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
9	A0A8I6ADP3	1350	1287	0.622	0.643	A0A8I6ADP3_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
10	A0A8I6AHN7	649	1302	0.310	0.317	A0A8I6AHN7_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
11	A0A8I6AT99	627	1248	0.255	0.272	A0A8I6AT99_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
12	A0A8I6GFX7	1506	1318	0.659	0.666	A0A8I6GFX7_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
13	A0A8I6GLD8	1536	1352	0.669	0.659	A0A8I6GLD8_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
14	D3ZZQ0	1389	1260	0.618	0.653	D3ZZQ0_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=2
15	F1LP90	2382	1336	0.967	0.964	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
16	F1M754	717	1146	0.318	0.370	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
17	M9PBJ7	591	1213	0.218	0.239	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
18	M9PH19	593	1404	0.218	0.207	M9PH19_DROME Misshapen, isoform F OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
19	O95819	699	1239	0.282	0.303	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
20	P83510	1543	1323	0.670	0.674	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.016	25.9	ABC1 atypical kinase-like domain
2	PF00780 CNH	4.6e-60	215.2	CNH domain
3	PF00069 Pkinase	3.8e-58	208.5	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.7e-42	156.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377036	0.989	Serine/threonine-protein phosphatase 2A activator
2	9606.ENSP00000343658	0.913	Mitogen-activated protein kinase kinase kinase kinase 4
3	9606.ENSP00000351908	0.910	Mitogen-activated protein kinase kinase kinase 5
4	9606.ENSP00000399511	0.902	TRAF2 and NCK-interacting protein kinase
5	9606.ENSP00000363641	0.900	Thioredoxin
6	9606.ENSP00000455625	0.896	cAMP-regulated phosphoprotein 19
7	9606.ENSP00000341743	0.872	Alpha-endosulfine
8	9606.ENSP00000293780	0.833	Acetylcholine receptor subunit epsilon
9	9606.ENSP00000417273	0.776	Cytoplasmic protein NCK1
10	9606.ENSP00000264977	0.758	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
11	9606.ENSP00000263918	0.746	Striatin
12	9606.ENSP00000324804	0.741	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
13	9606.ENSP00000375777	0.734	Striatin-4
14	9606.ENSP00000325074	0.710	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
15	9606.ENSP00000356549	0.704	Immediate early response gene 5 protein
16	9606.ENSP00000375080	0.689	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
17	9606.ENSP00000399970	0.689	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
18	9606.ENSP00000261461	0.671	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
19	9606.ENSP00000418447	0.663	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
20	9606.ENSP00000164133	0.652	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0097367	0.865	carbohydrate derivative binding
GO:0017076	0.857	purine nucleotide binding
GO:0043168	0.845	anion binding
GO:0032555	0.840	purine ribonucleotide binding
GO:0032559	0.833	adenyl ribonucleotide binding
GO:0035639	0.828	purine ribonucleoside triphosphate binding
GO:0005524	0.816	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0048583	0.919	regulation of response to stimulus
GO:0023051	0.909	regulation of signaling
GO:0010646	0.908	regulation of cell communication
GO:0048518	0.727	positive regulation of biological process
GO:0009966	0.681	regulation of signal transduction
GO:0071704	0.658	organic substance metabolic process
GO:0044237	0.654	cellular metabolic process
GO:0044238	0.653	primary metabolic process
GO:0050896	0.646	response to stimulus
GO:0006807	0.615	nitrogen compound metabolic process
GO:0048522	0.604	positive regulation of cellular process
GO:0043170	0.557	macromolecule metabolic process
GO:1901564	0.535	organonitrogen compound metabolic process
GO:0051716	0.452	cellular response to stimulus
GO:0023052	0.437	signaling
GO:0007165	0.429	signal transduction
GO:0019538	0.414	protein metabolic process
GO:0006796	0.364	phosphate-containing compound metabolic process
GO:0019222	0.362	regulation of metabolic process
GO:0071840	0.351	cellular component organization or biogenesis
GO:0036211	0.334	protein modification process
GO:0032501	0.322	multicellular organismal process
GO:0060255	0.320	regulation of macromolecule metabolic process
GO:0016043	0.315	cellular component organization
GO:0048519	0.310	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005829	0.994	cytosol
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0012505	0.959	endomembrane system
GO:0043232	0.918	intracellular non-membrane-bounded organelle
GO:0005576	0.853	extracellular region
GO:0070013	0.832	intracellular organelle lumen
GO:0031982	0.807	vesicle
GO:0005634	0.788	nucleus
GO:0005615	0.755	extracellular space
GO:0070062	0.719	extracellular exosome
GO:0030054	0.652	cell junction
GO:0016020	0.594	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]