StarFunc result for job id Q8N4H5

User Input

>input (51 residues)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8YXZ8	0.871	0.871	1.332E-6	51	1.000	1.000	A8YXZ8.pdb.gz	TOM5_BOVIN Mitochondrial import receptor subunit TOM5 homolog OS=Bos taurus OX=9913 GN=TOMM5 PE=3 SV=1
2	AFDB:P80967	0.692	0.705	1.722	50	0.275	0.280	P80967.pdb.gz	TOM5_YEAST Mitochondrial import receptor subunit TOM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM5 PE=1 SV=1
3	PDB:7o37V	0.449	0.437	3.193	53	0.118	0.113	7o37V.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
4	AFDB:Q9NRQ5	0.572	0.507	3.661	59	0.176	0.153	Q9NRQ5.pdb.gz	SMCO4_HUMAN Single-pass membrane and coiled-coil domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SMCO4 PE=1 SV=1
5	AFDB:Q581U0	0.561	0.078	3.980	515	0.235	0.023	Q581U0.pdb.gz	Q581U0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.610 PE=4 SV=1
6	AFDB:Q9XH48	0.558	0.336	3.980	87	0.118	0.069	Q9XH48.pdb.gz	TIM13_ARATH Mitochondrial import inner membrane translocase subunit TIM13 OS=Arabidopsis thaliana OX=3702 GN=TIM13 PE=1 SV=2
7	AFDB:Q6FLP9	0.468	0.066	5.118	446	0.137	0.016	Q6FLP9.pdb.gz	DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=DCW1 PE=3 SV=1
8	AFDB:Q8N6M0	0.659	0.130	5.118	293	0.078	0.014	Q8N6M0.pdb.gz	OTU6B_HUMAN Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B PE=1 SV=1
9	AFDB:P36091	0.467	0.064	5.565	449	0.137	0.016	P36091.pdb.gz	DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
10	AFDB:Q8SZZ8	0.546	0.053	6.051	684	0.176	0.013	Q8SZZ8.pdb.gz	ICE2_DROME Little elongation complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Ice2 PE=1 SV=1
11	AFDB:P53209	0.613	0.181	6.580	190	0.137	0.037	P53209.pdb.gz	YG1A_YEAST Uncharacterized membrane protein YGR016W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR016W PE=1 SV=1
12	PDB:5c0xC	0.208	0.038	7.379	339	0.118	0.018	5c0xC.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
13	PDB:7phrD	0.598	0.298	8.024	108	0.157	0.074	7phrD.pdb.gz	Structure of a fully assembled tumor-specific T cell receptor ligated by pMHC.
14	PDB:7btbm	0.485	0.060	9.487	469	0.137	0.015	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8YXZ8	3.25e-30	101	51	1.000	1.000	TOM5_BOVIN Mitochondrial import receptor subunit TOM5 homolog OS=Bos taurus OX=9913 GN=TOMM5 PE=3 SV=1
2	Q5R676	3.25e-30	101	51	1.000	1.000	TOM5_PONAB Mitochondrial import receptor subunit TOM5 homolog OS=Pongo abelii OX=9601 GN=TOMM5 PE=3 SV=1
3	Q8N4H5	3.25e-30	101	51	1.000	1.000	TOM5_HUMAN Mitochondrial import receptor subunit TOM5 homolog OS=Homo sapiens OX=9606 GN=TOMM5 PE=1 SV=1
4	B1AXP6	1.11e-29	100	51	0.961	0.961	TOM5_MOUSE Mitochondrial import receptor subunit TOM5 homolog OS=Mus musculus OX=10090 GN=Tomm5 PE=3 SV=1
5	F8W8Z9	7.83e-23	84.3	98	0.784	0.408	F8W8Z9_HUMAN Translocase of outer mitochondrial membrane 5 OS=Homo sapiens OX=9606 GN=TOMM5 PE=1 SV=1
6	Q288P3	0.76	28.5	1003	0.216	0.011	Q288P3_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr2a PE=2 SV=1
7	Q8I492	1.6	27.7	1434	0.294	0.010	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
8	O06577	1.8	27.3	414	0.196	0.024	O06577_MYCTU O-acyltransferase WSD1 C-terminal domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1125 PE=1 SV=1
9	Q8BKJ9	1.9	27.3	402	0.216	0.027	SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus OX=10090 GN=Sirt7 PE=1 SV=2
10	P97836	4.9	26.2	992	0.235	0.012	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
11	Q9LPE9	5.4	26.2	438	0.216	0.025	Q9LPE9_ARATH At1g44820 OS=Arabidopsis thaliana OX=3702 GN=At1g44820 PE=1 SV=1
12	O14490	5.5	26.2	977	0.235	0.012	DLGP1_HUMAN Disks large-associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10642 Tom5	9.3e-10	49.7	Mitochondrial import receptor subunit or translocase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006143796.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006169902.1	0.967	Translocase of outer mitochondrial membrane 7
2	246437.XP_006148642.1	0.955	Mitochondrial import receptor subunit TOM6 homolog isoform X1
3	246437.XP_006142215.1	0.888	Mitochondrial import receptor subunit TOM40 homolog
4	246437.XP_006163184.1	0.888	Mitochondrial import receptor subunit TOM40B
5	246437.XP_006153472.1	0.879	Metaxin-1
6	246437.XP_006162789.1	0.871	Mitofusin-1
7	246437.XP_006143651.1	0.870	Translocase of outer mitochondrial membrane 70
8	246437.XP_006148716.1	0.852	Mitochondrial import receptor subunit TOM22 homolog
9	246437.XP_006155441.1	0.852	Translocase of outer mitochondrial membrane 22
10	246437.XP_006146058.1	0.815	Translocase of outer mitochondrial membrane 20
11	246437.XP_006150726.1	0.786	Sorting and assembly machinery component 50 homolog
12	246437.XP_006145366.1	0.785	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
13	246437.XP_006151067.1	0.757	Mitochondrial import inner membrane translocase subunit Tim8 B
14	246437.XP_006170215.1	0.716	Mitochondrial import inner membrane translocase subunit Tim8 A
15	246437.XP_006145451.1	0.701	dnaJ homolog subfamily C member 11 isoform X1
16	246437.XP_006151162.1	0.664	Metaxin-2-like isoform X1
17	246437.XP_006143580.1	0.643	Metaxin 3
18	246437.XP_006167577.1	0.640	Mitochondrial import inner membrane translocase subunit Tim22
19	246437.XP_006144931.1	0.616	Translocase of outer mitochondrial membrane 20 like
20	246437.XP_006169972.1	0.599	Heat shock protein family A (Hsp70) member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.998	transporter activity
GO:0022857	0.966	transmembrane transporter activity
GO:0022884	0.947	macromolecule transmembrane transporter activity
GO:0140318	0.929	protein transporter activity
GO:0008320	0.827	protein transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0006626	0.761	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031966	0.999	mitochondrial membrane
GO:0098798	0.977	mitochondrial protein-containing complex
GO:0098796	0.967	membrane protein complex
GO:0098588	0.943	bounding membrane of organelle
GO:0031968	0.890	organelle outer membrane
GO:0005741	0.857	mitochondrial outer membrane
GO:0098799	0.666	outer mitochondrial membrane protein complex
GO:0005742	0.635	mitochondrial outer membrane translocase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]