StarFunc result for job id Q8N4P3

User Input

>input (179 residues)
MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKL
ADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N4P3	1.000	1.000	1.691E-27	179	1.000	1.000	Q8N4P3.pdb.gz	MESH1_HUMAN Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3 PE=1 SV=3
2	PDB:3nr1A	0.989	0.994	6.229E-26	178	0.994	1.000	3nr1A.pdb.gz	A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses
3	AFDB:Q9VAM9	0.962	0.962	3.928E-19	179	0.581	0.581	Q9VAM9.pdb.gz	MESH1_DROME Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Drosophila melanogaster OX=7227 GN=Mesh1 PE=1 SV=1
4	PDB:3nqwA	0.954	0.960	1.447E-17	178	0.581	0.584	3nqwA.pdb.gz	A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses
5	AFDB:P52560	0.757	0.174	2.262E-6	847	0.291	0.061	P52560.pdb.gz	RELA_STRCO GTP pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=relA PE=3 SV=1
6	AFDB:Q9LVJ3	0.705	0.192	3.862E-6	709	0.263	0.066	Q9LVJ3.pdb.gz	RSH2C_ARATH Probable GTP diphosphokinase RSH2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH2 PE=2 SV=1
7	AFDB:P0AG24	0.658	0.183	4.469E-6	702	0.291	0.074	P0AG24.pdb.gz	SPOT_ECOLI Bifunctional (p)ppGpp synthase/hydrolase SpoT OS=Escherichia coli (strain K12) OX=83333 GN=spoT PE=1 SV=1
8	AFDB:P9WHG9	0.739	0.195	9.270E-6	738	0.302	0.073	P9WHG9.pdb.gz	RELA_MYCTU Bifunctional (p)ppGpp synthase/hydrolase RelA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=relA PE=1 SV=1
9	AFDB:Q9SYH1	0.748	0.204	9.270E-6	715	0.251	0.063	Q9SYH1.pdb.gz	RSH3C_ARATH Probable GTP diphosphokinase RSH3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH3 PE=2 SV=1
10	AFDB:F4JHA2	0.732	0.161	1.346E-4	884	0.296	0.060	F4JHA2.pdb.gz	RSH1C_ARATH Putative GTP diphosphokinase RSH1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH1 PE=1 SV=1
11	PDB:5iqr8	0.709	0.229	3.415E-4	615	0.184	0.054	5iqr8.pdb.gz	Ribosome-dependent activation of stringent control.
12	AFDB:Q9I524	0.680	0.179	8.547E-4	747	0.223	0.054	Q9I524.pdb.gz	Q9I524_PSEAE GTP pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=relA PE=3 SV=1
13	PDB:5kpv33	0.666	0.198	1.152E-3	675	0.196	0.052	5kpv33.pdb.gz	Ribosome•RelA structures reveal the mechanism of stringent response activation.
14	AFDB:Q84R11	0.688	0.234	6.280E-3	583	0.179	0.055	Q84R11.pdb.gz	CRSH_ARATH Probable GTP diphosphokinase CRSH, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRSH PE=2 SV=1
15	PDB:4v1nM	0.272	0.179	3.414E-1	299	0.140	0.084	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
16	PDB:6yl2B	0.216	0.205	4.354E-1	192	0.123	0.115	6yl2B.pdb.gz	Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
17	PDB:3lomA	0.216	0.159	1.045	288	0.123	0.076	3lomA.pdb.gz
18	PDB:6ww7B	0.211	0.160	1.097	281	0.179	0.114	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
19	PDB:2parB	0.345	0.345	1.152	178	0.162	0.163	2parB.pdb.gz	Structural insight into the mechanism of substrate specificity and catalytic activity of an HD-domain phosphohydrolase: the 5'-deoxyribonucleotidase YfbR from Escherichia coli.
20	PDB:4horA	0.326	0.157	1.152	482	0.156	0.058	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N4P3	2.41e-131	367	179	1.000	1.000	MESH1_HUMAN Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3 PE=1 SV=3
2	Q9VAM9	5.47e-66	201	179	0.575	0.575	MESH1_DROME Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Drosophila melanogaster OX=7227 GN=Mesh1 PE=1 SV=1
3	P9WHG9	3.67e-14	71.6	738	0.302	0.073	RELA_MYCTU Bifunctional (p)ppGpp synthase/hydrolase RelA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=relA PE=1 SV=1
4	P52560	3.63e-13	68.9	847	0.296	0.063	RELA_STRCO GTP pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=relA PE=3 SV=1
5	F4JHA2	3.37e-12	66.2	884	0.302	0.061	RSH1C_ARATH Putative GTP diphosphokinase RSH1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH1 PE=1 SV=1
6	P0AG24	6.45e-12	65.1	702	0.285	0.073	SPOT_ECOLI Bifunctional (p)ppGpp synthase/hydrolase SpoT OS=Escherichia coli (strain K12) OX=83333 GN=spoT PE=1 SV=1
7	Q9LVJ3	2.73e-11	63.5	709	0.302	0.076	RSH2C_ARATH Probable GTP diphosphokinase RSH2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH2 PE=2 SV=1
8	Q9SYH1	3.85e-09	57.0	715	0.251	0.063	RSH3C_ARATH Probable GTP diphosphokinase RSH3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RSH3 PE=2 SV=1
9	F6SEU4	0.11	35.0	1340	0.145	0.019	SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus OX=10090 GN=Syngap1 PE=1 SV=2
10	Q96PV0	0.11	35.0	1343	0.145	0.019	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
11	Q9QUH6	0.11	35.0	1308	0.145	0.020	SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus OX=10116 GN=Syngap1 PE=1 SV=2
12	Q9I524	1.9	31.2	747	0.162	0.039	Q9I524_PSEAE GTP pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=relA PE=3 SV=1
13	Q25733	4.5	30.4	2924	0.117	0.007	Q25733_PLAFA PfEMP1 variant 1 of strain MC OS=Plasmodium falciparum OX=5833 GN=MCvar-1 PfEMP1 PE=1 SV=1
14	Q9U1Y5	5.4	30.0	476	0.168	0.063	CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans OX=6239 GN=chk-2 PE=2 SV=2
15	Q80UG8	9.0	29.3	1193	0.101	0.015	TTLL4_MOUSE Tubulin monoglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01966 HD	0.031	25.9	HD domain
2	PF13328 HD_4	1.4e-18	78.7	HD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219302	0.923	Nucleoside diphosphate kinase 3
2	9606.ENSP00000416658	0.921	Nucleoside diphosphate kinase 6
3	9606.ENSP00000307674	0.920	Soluble calcium-activated nucleotidase 1
4	9606.ENSP00000300738	0.919	Ribonucleoside-diphosphate reductase large subunit
5	9606.ENSP00000337060	0.918	Nucleoside diphosphate kinase A
6	9606.ENSP00000376886	0.918	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
7	9606.ENSP00000376889	0.918	Nucleoside diphosphate kinase
8	9606.ENSP00000355689	0.917	Guanylate kinase
9	9606.ENSP00000219479	0.916	Nucleoside diphosphate kinase, mitochondrial
10	9606.ENSP00000356785	0.916	Nucleoside diphosphate kinase 7
11	9606.ENSP00000320171	0.910	Pyruvate kinase PKM
12	9606.ENSP00000339933	0.910	Pyruvate kinase PKLR
13	9606.ENSP00000410186	0.908	Adenylate kinase 9
14	9606.ENSP00000271620	0.907	Exopolyphosphatase PRUNE1
15	9606.ENSP00000251810	0.903	Ribonucleoside-diphosphate reductase subunit M2 B
16	9606.ENSP00000301825	0.900	Ectonucleoside triphosphate diphosphohydrolase 3
17	9606.ENSP00000335246	0.900	Ectonucleoside triphosphate diphosphohydrolase 5
18	9606.ENSP00000351520	0.900	Ectonucleoside triphosphate diphosphohydrolase 4
19	9606.ENSP00000353770	0.900	Ribonucleoside-diphosphate reductase subunit M2
20	9606.ENSP00000360250	0.900	Ectonucleoside triphosphate diphosphohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.980	catalytic activity
GO:0016787	0.865	hydrolase activity
GO:0016788	0.676	hydrolase activity, acting on ester bonds
GO:0042578	0.393	phosphoric ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0009117	0.993	nucleotide metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:0019693	0.973	ribose phosphate metabolic process
GO:0044248	0.891	cellular catabolic process
GO:0009259	0.844	ribonucleotide metabolic process
GO:0046700	0.819	heterocycle catabolic process
GO:0044270	0.819	cellular nitrogen compound catabolic process
GO:1901361	0.811	organic cyclic compound catabolic process
GO:0019439	0.808	aromatic compound catabolic process
GO:0034655	0.797	nucleobase-containing compound catabolic process
GO:0050896	0.754	response to stimulus
GO:0072521	0.725	purine-containing compound metabolic process
GO:0046434	0.696	organophosphate catabolic process
GO:1901292	0.601	nucleoside phosphate catabolic process
GO:0006163	0.505	purine nucleotide metabolic process
GO:0006950	0.446	response to stress
GO:0009991	0.424	response to extracellular stimulus
GO:0009150	0.423	purine ribonucleotide metabolic process
GO:0033875	0.419	ribonucleoside bisphosphate metabolic process
GO:0034032	0.419	purine nucleoside bisphosphate metabolic process
GO:1901576	0.411	organic substance biosynthetic process
GO:0031667	0.410	response to nutrient levels
GO:0044249	0.410	cellular biosynthetic process
GO:0009166	0.378	nucleotide catabolic process
GO:0042594	0.376	response to starvation
GO:1901565	0.365	organonitrogen compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.994	cytosol
GO:0043231	0.850	intracellular membrane-bounded organelle
GO:0070013	0.572	intracellular organelle lumen
GO:0032991	0.401	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.865	Hydrolases.
EC:3.1.-.-	0.676	Acting on ester bonds.

[back to server]