StarFunc result for job id Q8N4Q0

User Input

>input (377 residues)
MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVTLSRDCPVPLP
GDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA
VAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTA
AAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEG
VDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASV
QGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGK
NTGKIVVELPHSVNSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGC4	0.968	0.968	2.328E-75	377	0.881	0.881	Q8BGC4.pdb.gz	PTGR3_MOUSE Prostaglandin reductase-3 OS=Mus musculus OX=10090 GN=Ptgr3 PE=1 SV=1
2	AFDB:Q38A19	0.844	0.950	7.257E-44	334	0.422	0.476	Q38A19.pdb.gz	Q38A19_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0820 PE=4 SV=1
3	AFDB:F4I3C3	0.870	0.508	1.511E-43	652	0.422	0.244	F4I3C3.pdb.gz	F4I3C3_ARATH ARP protein (REF) OS=Arabidopsis thaliana OX=3702 GN=NQR PE=1 SV=1
4	AFDB:Q3UNZ8	0.771	0.828	1.168E-29	350	0.255	0.274	Q3UNZ8.pdb.gz	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
5	AFDB:P38230	0.768	0.861	1.492E-29	334	0.236	0.266	P38230.pdb.gz	QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZTA1 PE=1 SV=1
6	AFDB:A1L4Y4	0.780	0.727	1.686E-29	406	0.271	0.251	A1L4Y4.pdb.gz	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
7	AFDB:Q9LXZ4	0.778	0.840	2.068E-28	348	0.257	0.279	Q9LXZ4.pdb.gz	Q9LXZ4_ARATH GroES-like zinc-binding alcohol dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=T5P19_110 PE=1 SV=1
8	AFDB:Q3MIE4	0.770	0.721	2.337E-28	404	0.281	0.262	Q3MIE4.pdb.gz	VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1
9	AFDB:Q6WAU0	0.771	0.845	4.051E-28	342	0.249	0.275	Q6WAU0.pdb.gz	PULR_MENPI (+)-pulegone reductase OS=Mentha piperita OX=34256 PE=1 SV=1
10	PDB:3qwaB	0.716	0.801	8.530E-28	332	0.236	0.268	3qwaB.pdb.gz
11	AFDB:Q9I0Z1	0.718	0.790	1.146E-27	339	0.212	0.236	Q9I0Z1.pdb.gz	Q9I0Z1_PSEAE Probable oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2491 PE=4 SV=1
12	PDB:2obyA	0.712	0.795	2.898E-27	334	0.239	0.269	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
13	PDB:1yb5A	0.754	0.869	1.605E-26	324	0.215	0.250	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
14	PDB:6k9yA	0.755	0.829	2.179E-26	342	0.260	0.287	6k9yA.pdb.gz
15	PDB:2dm6B	0.729	0.817	2.618E-26	333	0.218	0.246	2dm6B.pdb.gz	Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy
16	PDB:1qorA	0.753	0.863	5.453E-26	326	0.220	0.255	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
17	PDB:1wlyA	0.692	0.796	5.568E-25	322	0.244	0.286	1wlyA.pdb.gz
18	PDB:2zb3A	0.756	0.822	7.560E-25	345	0.220	0.241	2zb3A.pdb.gz	Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
19	PDB:4rvuA	0.757	0.861	1.160E-24	329	0.257	0.295	4rvuA.pdb.gz	Structural views of quinone oxidoreductase from Mycobacterium tuberculosis reveal large conformational changes induced by the co-factor.
20	PDB:2w98B	0.730	0.771	1.892E-24	355	0.231	0.245	2w98B.pdb.gz	Crystal Structure of Human Zinc-Binding Alcohol Dehydrogenase 1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGC4	0.0	670	377	0.859	0.859	PTGR3_MOUSE Prostaglandin reductase-3 OS=Mus musculus OX=10090 GN=Ptgr3 PE=1 SV=1
2	Q38A19	5.56e-87	268	334	0.422	0.476	Q38A19_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0820 PE=4 SV=1
3	F4I3C3	2.20e-84	271	652	0.416	0.241	F4I3C3_ARATH ARP protein (REF) OS=Arabidopsis thaliana OX=3702 GN=NQR PE=1 SV=1
4	A1L4Y4	3.26e-30	121	406	0.228	0.212	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
5	Q9C0Y6	1.81e-28	115	349	0.233	0.252	YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB24D3.08c PE=3 SV=1
6	Q9FKC9	3.79e-28	115	353	0.220	0.235	Q9FKC9_ARATH Allyl alcohol dehydrogenase; NADP-dependent oxidoreductase-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g37980 PE=1 SV=1
7	Q6WAU0	3.80e-27	112	342	0.260	0.287	PULR_MENPI (+)-pulegone reductase OS=Mentha piperita OX=34256 PE=1 SV=1
8	Q53FA7	1.25e-26	110	332	0.260	0.295	QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2
9	Q39172	2.88e-25	107	345	0.210	0.229	AER_ARATH NADPH-dependent oxidoreductase 2-alkenal reductase OS=Arabidopsis thaliana OX=3702 GN=AER PE=1 SV=1
10	P72043	4.22e-25	106	328	0.233	0.268	P72043_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3777 PE=1 SV=2
11	Q9C677	8.03e-25	105	351	0.257	0.276	Q9C677_ARATH Allyl alcohol dehydrogenase, putative OS=Arabidopsis thaliana OX=3702 GN=At1g26320 PE=1 SV=1
12	F4KFK3	8.80e-25	104	305	0.183	0.226	F4KFK3_ARATH Zinc-binding dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g16980 PE=1 SV=1
13	O53146	1.78e-24	104	328	0.215	0.247	O53146_MYCTU Probable quinone reductase Qor (NADPH:quinone reductase) (Zeta-crystallin homolog protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qor PE=1 SV=3
14	Q93Z72	1.89e-24	104	345	0.188	0.206	Q93Z72_ARATH AT5g16970/F2K13_120 OS=Arabidopsis thaliana OX=3702 GN=At5g17000 PE=1 SV=1
15	Q59I44	3.10e-24	103	333	0.199	0.225	CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. OX=36773 GN=caa43 PE=1 SV=1
16	Q9M9M7	4.31e-24	103	350	0.180	0.194	Q9M9M7_ARATH Putative NADP-dependent oxidoreductase OS=Arabidopsis thaliana OX=3702 GN=At3g03080 PE=1 SV=1
17	Q9LFK5	1.64e-23	102	346	0.212	0.231	Q9LFK5_ARATH Quinone oxidoreductase-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g16960 PE=1 SV=1
18	O65423	2.29e-23	101	325	0.231	0.268	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
19	Q39173	2.93e-23	101	343	0.215	0.236	P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana OX=3702 GN=P2 PE=2 SV=2
20	P97584	3.73e-23	100	329	0.188	0.216	PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus OX=10116 GN=Ptgr1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	7.7e-05	33.9	Alcohol dehydrogenase GroES-like domain
2	PF16884 ADH_N_2	7.5	17.9	N-terminal domain of oxidoreductase
3	PF00107 ADH_zinc_N	6e-21	86.2	Zinc-binding dehydrogenase
4	PF13602 ADH_zinc_N_2	4.6e-08	45.6	Zinc-binding dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379865	0.737	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
2	9606.ENSP00000462106	0.701	Small integral membrane protein 21
3	9606.ENSP00000264990	0.692	Acyl-CoA dehydrogenase family member 11
4	9606.ENSP00000299687	0.687	Zinc finger protein 407
5	9606.ENSP00000264896	0.683	Lysosome membrane protein 2
6	9606.ENSP00000287078	0.670	Peroxisomal leader peptide-processing protease
7	9606.ENSP00000323584	0.668	Teashirt homolog 1
8	9606.ENSP00000296522	0.656	15-hydroxyprostaglandin dehydrogenase [NAD(+)]
9	9606.ENSP00000391601	0.624	Peroxisomal targeting signal 1 receptor
10	9606.ENSP00000334474	0.605	Zinc finger MIZ domain-containing protein 1
11	9606.ENSP00000370966	0.605	Quinone oxidoreductase-like protein 1
12	9606.ENSP00000444156	0.602	Armadillo repeat containing 6
13	9606.ENSP00000483936	0.599	Synaptotagmin-like protein 3
14	9606.ENSP00000263702	0.593	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
15	9606.ENSP00000012049	0.584	Glutaminyl-peptide cyclotransferase-like protein
16	9606.ENSP00000378857	0.581	WD repeat-containing protein 6
17	9606.ENSP00000241052	0.570	Catalase
18	9606.ENSP00000394757	0.565	Zinc finger protein 516
19	9606.ENSP00000426159	0.556	Uncharacterized protein C6orf223
20	9606.ENSP00000315680	0.555	Peroxisomal targeting signal 2 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005488	0.983	binding
GO:0005515	0.800	protein binding
GO:0043167	0.688	ion binding
GO:0016627	0.637	oxidoreductase activity, acting on the CH-CH group of donors
GO:0097159	0.611	organic cyclic compound binding
GO:1901363	0.610	heterocyclic compound binding
GO:0016628	0.531	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0036094	0.378	small molecule binding
GO:0043169	0.343	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.967	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0050794	0.769	regulation of cellular process
GO:0050793	0.575	regulation of developmental process
GO:0048519	0.510	negative regulation of biological process
GO:0009987	0.398	cellular process
GO:0051093	0.386	negative regulation of developmental process
GO:0045598	0.321	regulation of fat cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005777	0.934	peroxisome
GO:0070013	0.389	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.3.-.-	0.637	Acting on the CH-CH group of donors.
EC:1.3.1.-	0.531	With NAD(+) or NADP(+) as acceptor.

[back to server]