StarFunc result for job id Q8N4Q1

User Input

>input (142 residues)
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMA
SGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKP
AEQAEETAPIEATATKEEEGSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2I5	0.773	0.773	5.040E-25	142	1.000	1.000	A0A024R2I5.pdb.gz
2	AFDB:Q8VEA4	0.696	0.710	5.493E-21	139	0.859	0.878	Q8VEA4.pdb.gz	MIA40_MOUSE Mitochondrial intermembrane space import and assembly protein 40 OS=Mus musculus OX=10090 GN=Chchd4 PE=1 SV=1
3	PDB:2k3jA	0.415	0.848	9.217E-9	65	0.458	1.000	2k3jA.pdb.gz
4	AFDB:P87059	0.443	0.203	5.779E-8	313	0.324	0.147	P87059.pdb.gz	MIA40_SCHPO Mitochondrial intermembrane space import and assembly protein 40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mia40 PE=3 SV=1
5	AFDB:P36046	0.464	0.172	1.878E-7	403	0.423	0.149	P36046.pdb.gz	MIA40_YEAST Mitochondrial intermembrane space import and assembly protein 40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIA40 PE=1 SV=2
6	PDB:3a3cA	0.440	0.141	1.425E-6	451	0.282	0.089	3a3cA.pdb.gz	Structural basis of yeast Tim40/Mia40 as an oxidative translocator in the mitochondrial intermembrane space.
7	AFDB:Q8GYJ4	0.392	0.347	4.592E-5	162	0.289	0.253	Q8GYJ4.pdb.gz	MIA40_ARATH Mitochondrial intermembrane space import and assembly protein 40 homolog OS=Arabidopsis thaliana OX=3702 GN=MIA40 PE=2 SV=1
8	PDB:7qske	0.245	0.341	4.101E-1	99	0.063	0.091	7qske.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
9	AFDB:O54568	0.200	0.229	7.413E-1	120	0.113	0.133	O54568.pdb.gz	O54568_LEGPN IcmR protein OS=Legionella pneumophila OX=446 GN=icmR PE=1 SV=1
10	PDB:6zr2e	0.247	0.325	7.893E-1	105	0.077	0.105	6zr2e.pdb.gz	Structure of inhibitor-bound mammalian complex I.
11	AFDB:P35548	0.169	0.112	1.252	267	0.155	0.082	P35548.pdb.gz	MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=3
12	AFDB:A0A024RB51	0.166	0.102	1.336	264	0.134	0.072	A0A024RB51.pdb.gz
13	AFDB:F4KAJ5	0.148	0.096	1.336	264	0.183	0.098	F4KAJ5.pdb.gz	F4KAJ5_ARATH Basic helix-loop-helix (BHLH) DNA-binding superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MUL3.10 PE=1 SV=1
14	AFDB:A1L162	0.184	0.170	1.523	156	0.169	0.154	A1L162.pdb.gz	ERIC2_HUMAN Glutamate-rich protein 2 OS=Homo sapiens OX=9606 GN=ERICH2 PE=1 SV=1
15	PDB:6i3yA	0.232	0.412	2.107	74	0.077	0.149	6i3yA.pdb.gz	Structural determinants of lipid specificity within Ups/PRELI lipid transfer proteins.
16	PDB:7l08r	0.117	0.105	2.402	162	0.148	0.130	7l08r.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:6iegA	0.143	0.038	5.626	872	0.113	0.018	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
18	PDB:4jk1D	0.177	0.027	6.413	1160	0.021	0.003	4jk1D.pdb.gz	Differential regulation by ppGpp versus pppGpp in Escherichia coli.
19	PDB:1ub4C	0.105	0.181	6.847	75	0.014	0.027	1ub4C.pdb.gz
20	PDB:6mzcK	0.164	0.127	7.310	202	0.106	0.074	6mzcK.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N4Q1	7.58e-104	294	142	1.000	1.000	MIA40_HUMAN Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1
2	Q8VEA4	3.49e-84	244	139	0.859	0.878	MIA40_MOUSE Mitochondrial intermembrane space import and assembly protein 40 OS=Mus musculus OX=10090 GN=Chchd4 PE=1 SV=1
3	P87059	2.86e-27	104	313	0.331	0.150	MIA40_SCHPO Mitochondrial intermembrane space import and assembly protein 40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mia40 PE=3 SV=1
4	P36046	1.32e-25	102	403	0.324	0.114	MIA40_YEAST Mitochondrial intermembrane space import and assembly protein 40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIA40 PE=1 SV=2
5	Q8GYJ4	1.97e-13	65.5	162	0.190	0.167	MIA40_ARATH Mitochondrial intermembrane space import and assembly protein 40 homolog OS=Arabidopsis thaliana OX=3702 GN=MIA40 PE=2 SV=1
6	Q06488	0.38	32.7	889	0.141	0.022	RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC2 PE=1 SV=1
7	P38824	0.53	31.6	151	0.162	0.152	COX23_YEAST Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX23 PE=1 SV=1
8	Q80U30	2.7	30.4	1036	0.162	0.022	CL16A_MOUSE Protein CLEC16A OS=Mus musculus OX=10090 GN=Clec16a PE=1 SV=2
9	P13596	3.7	29.6	858	0.127	0.021	NCAM1_RAT Neural cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ncam1 PE=1 SV=1
10	Q2KHT3	3.7	29.6	1053	0.162	0.022	CL16A_HUMAN Protein CLEC16A OS=Homo sapiens OX=9606 GN=CLEC16A PE=1 SV=2
11	P58307	4.9	29.3	416	0.106	0.036	OX1R_MOUSE Orexin/Hypocretin receptor type 1 OS=Mus musculus OX=10090 GN=Hcrtr1 PE=2 SV=3
12	P56718	5.2	29.3	416	0.106	0.036	OX1R_RAT Orexin/Hypocretin receptor type 1 OS=Rattus norvegicus OX=10116 GN=Hcrtr1 PE=2 SV=1
13	Q94FL9	5.3	29.3	961	0.120	0.018	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
14	A0A1D8PJN3	5.9	29.3	1479	0.113	0.011	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
15	O43613	6.6	28.9	425	0.106	0.035	OX1R_HUMAN Orexin/Hypocretin receptor type 1 OS=Homo sapiens OX=9606 GN=HCRTR1 PE=1 SV=2
16	P98197	7.0	28.9	1187	0.099	0.012	AT11A_MOUSE Phospholipid-transporting ATPase IH OS=Mus musculus OX=10090 GN=Atp11a PE=1 SV=1
17	P0C6X1	8.7	28.9	6758	0.155	0.003	R1AB_CVH22 Replicase polyprotein 1ab OS=Human coronavirus 229E OX=11137 GN=rep PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	2.3e-06	38.8	CHCH domain
2	PF07802 GCK	23	16.8	GCK domain
3	PF10200 Ndufs5	3.4e+02	12.9	NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
4	PF03517 Voldacs	4.8e+02	12.3	Regulator of volume decrease after cellular swelling

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005997

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010943	0.984	Sulfhydryl oxidase
2	61853.ENSNLEP00000006074	0.961	COX17 cytochrome c oxidase copper chaperone
3	61853.ENSNLEP00000016100	0.952	Translocase of inner mitochondrial membrane 9 homolog (yeast)
4	61853.ENSNLEP00000015522	0.947	Translocase of inner mitochondrial membrane 10 homolog (yeast)
5	61853.ENSNLEP00000002722	0.923	Translocase of inner mitochondrial membrane 13 homolog (yeast)
6	61853.ENSNLEP00000021153	0.868	Uncharacterized protein
7	61853.ENSNLEP00000009161	0.867	Uncharacterized protein
8	61853.ENSNLEP00000014232	0.861	Cytochrome c oxidase assembly homolog 19 (S. cerevisiae)
9	61853.ENSNLEP00000003320	0.805	MICOS complex subunit MIC60
10	61853.ENSNLEP00000020758	0.789	Cytochrome c oxidase assembly factor 4 homolog (S. cerevisiae)
11	61853.ENSNLEP00000001484	0.785	Coiled-coil-helix-coiled-coil-helix domain containing 7
12	61853.ENSNLEP00000019179	0.774	Coiled-coil-helix-coiled-coil-helix domain containing 2
13	61853.ENSNLEP00000000594	0.771	Coiled-coil-helix-coiled-coil-helix domain containing 10
14	61853.ENSNLEP00000002063	0.767	Coiled-coil-helix-coiled-coil-helix domain containing 5
15	61853.ENSNLEP00000008895	0.752	Translocase of inner mitochondrial membrane 8 homolog B (yeast)
16	61853.ENSNLEP00000022694	0.752	Uncharacterized protein
17	61853.ENSNLEP00000003029	0.750	Cytochrome c oxidase assembly factor 6 homolog (S. cerevisiae)
18	61853.ENSNLEP00000018972	0.739	TP53 regulated inhibitor of apoptosis 1
19	61853.ENSNLEP00000015755	0.725	MICOS complex subunit
20	61853.ENSNLEP00000020844	0.721	Mitochondrial inner membrane protease ATP23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.950	catalytic activity
GO:0016491	0.693	oxidoreductase activity
GO:0015036	0.572	disulfide oxidoreductase activity
GO:0015035	0.548	protein-disulfide reductase activity
GO:0016671	0.373	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0006807	0.968	nitrogen compound metabolic process
GO:0033108	0.965	mitochondrial respiratory chain complex assembly
GO:0044238	0.958	primary metabolic process
GO:0071704	0.957	organic substance metabolic process
GO:0072594	0.947	establishment of protein localization to organelle
GO:0072655	0.940	establishment of protein localization to mitochondrion
GO:0043170	0.907	macromolecule metabolic process
GO:0006810	0.665	transport
GO:0071702	0.560	organic substance transport
GO:0044237	0.497	cellular metabolic process
GO:0006839	0.486	mitochondrial transport
GO:0006605	0.462	protein targeting
GO:0006626	0.450	protein targeting to mitochondrion
GO:0065007	0.435	biological regulation
GO:0050789	0.398	regulation of biological process
GO:0050794	0.329	regulation of cellular process
GO:1901564	0.307	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0005740	0.924	mitochondrial envelope
GO:0031090	0.815	organelle membrane
GO:0005758	0.401	mitochondrial intermembrane space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.693	Oxidoreductases.
EC:1.8.-.-	0.572	Acting on a sulfur group of donors.
EC:1.8.4.-	0.373	With a disulfide as acceptor.

[back to server]