StarFunc result for job id Q8N4T8

User Input

>input (237 residues)
MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKE
HDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMR
TMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGF
VHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N4T8	1.000	1.000	3.464E-50	237	1.000	1.000	Q8N4T8.pdb.gz	CBR4_HUMAN 3-oxoacyl-[acyl-carrier-protein] reductase OS=Homo sapiens OX=9606 GN=CBR4 PE=1 SV=3
2	AFDB:Q91VT4	0.994	0.999	1.249E-44	236	0.861	0.864	Q91VT4.pdb.gz	CBR4_MOUSE 3-oxoacyl-[acyl-carrier-protein] reductase OS=Mus musculus OX=10090 GN=Cbr4 PE=1 SV=2
3	PDB:4cqmF	0.984	0.968	1.421E-43	241	0.996	0.979	4cqmF.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
4	AFDB:P0A2C9	0.949	0.923	3.884E-28	244	0.414	0.402	P0A2C9.pdb.gz	FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=fabG PE=1 SV=1
5	AFDB:Q8I2S7	0.940	0.744	8.302E-28	301	0.380	0.299	Q8I2S7.pdb.gz	Q8I2S7_PLAF7 3-oxoacyl-[acyl-carrier-protein] reductase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0922900 PE=1 SV=1
6	AFDB:A0QYC2	0.960	0.877	2.832E-27	260	0.401	0.365	A0QYC2.pdb.gz	DTHD_MYCS2 D-threitol dehydrogenase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dthD PE=1 SV=1
7	AFDB:P33207	0.941	0.704	3.577E-27	319	0.405	0.301	P33207.pdb.gz	FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g24360 PE=1 SV=2
8	AFDB:P39071	0.951	0.865	7.645E-27	261	0.321	0.291	P39071.pdb.gz	DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbA PE=1 SV=3
9	AFDB:Q32S21	0.939	0.861	1.541E-26	259	0.346	0.317	Q32S21.pdb.gz	Q32S21_BOVIN FabG-like protein OS=Bos taurus OX=9913 GN=HSD17B8 PE=2 SV=1
10	AFDB:Q9L9F8	0.934	0.847	1.541E-26	262	0.367	0.332	Q9L9F8.pdb.gz	NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus OX=193462 GN=novJ PE=1 SV=1
11	AFDB:P50171	0.949	0.870	1.947E-26	259	0.363	0.332	P50171.pdb.gz	DHB8_MOUSE (3R)-3-hydroxyacyl-CoA dehydrogenase OS=Mus musculus OX=10090 GN=Hsd17b8 PE=1 SV=2
12	PDB:6t7mD	0.937	0.893	3.223E-26	249	0.414	0.394	6t7mD.pdb.gz
13	PDB:2c07A	0.917	0.885	3.622E-26	246	0.367	0.354	2c07A.pdb.gz
14	PDB:4cqlI	0.945	0.893	1.012E-24	251	0.350	0.331	4cqlI.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
15	PDB:6emmA	0.939	0.833	4.114E-24	268	0.312	0.276	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
16	PDB:1nffA	0.948	0.921	6.960E-24	244	0.329	0.320	1nffA.pdb.gz	Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
17	PDB:3ndrA	0.934	0.898	1.048E-23	247	0.295	0.283	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
18	PDB:3u4cA	0.915	0.856	1.992E-23	254	0.270	0.252	3u4cA.pdb.gz	Structural insights into the role of Bacillus subtilis YwfH (BacG) in tetrahydrotyrosine synthesis
19	PDB:2ewmB	0.914	0.879	9.100E-23	247	0.300	0.287	2ewmB.pdb.gz	Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
20	PDB:1uznA	0.902	0.894	9.648E-23	239	0.350	0.347	1uznA.pdb.gz	Crystal Structure of Maba from Mycobacterium Tuberculosis, a Reductase Involved in Long-Chain Fatty Acid Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N4T8	2.08e-173	478	237	1.000	1.000	CBR4_HUMAN 3-oxoacyl-[acyl-carrier-protein] reductase OS=Homo sapiens OX=9606 GN=CBR4 PE=1 SV=3
2	Q91VT4	2.21e-151	422	236	0.861	0.864	CBR4_MOUSE 3-oxoacyl-[acyl-carrier-protein] reductase OS=Mus musculus OX=10090 GN=Cbr4 PE=1 SV=2
3	P0AEK2	3.67e-59	189	244	0.422	0.410	FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) OX=83333 GN=fabG PE=1 SV=1
4	P0A2C9	1.73e-57	184	244	0.414	0.402	FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=fabG PE=1 SV=1
5	P33207	6.87e-52	172	319	0.418	0.310	FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g24360 PE=1 SV=2
6	Q8I2S7	8.43e-50	166	301	0.384	0.302	Q8I2S7_PLAF7 3-oxoacyl-[acyl-carrier-protein] reductase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0922900 PE=1 SV=1
7	P9WGT3	4.05e-42	145	247	0.367	0.352	MABA_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase MabA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mabA PE=1 SV=1
8	P52037	4.41e-38	135	247	0.388	0.372	YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) OX=83333 GN=ygfF PE=1 SV=2
9	Q9L9F8	2.19e-36	130	262	0.380	0.344	NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus OX=193462 GN=novJ PE=1 SV=1
10	O42866	3.62e-36	129	236	0.333	0.335	FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oar2 PE=3 SV=1
11	Q92506	6.55e-36	129	261	0.359	0.326	DHB8_HUMAN (3R)-3-hydroxyacyl-CoA dehydrogenase OS=Homo sapiens OX=9606 GN=HSD17B8 PE=1 SV=2
12	A0QYC2	3.00e-34	125	260	0.359	0.327	DTHD_MYCS2 D-threitol dehydrogenase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dthD PE=1 SV=1
13	Q9LHT0	3.80e-33	122	264	0.359	0.322	TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana OX=3702 GN=At5g06060 PE=2 SV=1
14	Q585V0	1.92e-31	117	241	0.342	0.336	Q585V0_TRYB2 3-oxoacyl-(Acyl-carrier protein) reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.55 PE=4 SV=1
15	P50166	6.19e-31	117	282	0.346	0.291	ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis OX=5482 GN=ARD PE=1 SV=1
16	Q99714	1.10e-30	116	261	0.333	0.303	HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3
17	P07914	1.98e-30	115	249	0.316	0.301	BAIA1_CLOSV 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) OX=29347 GN=baiA1 PE=1 SV=3
18	A0A384JQF5	2.73e-30	115	258	0.363	0.333	ABA4_BOTFB Short-chain dehydrogenase/reductase aba4 OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=aba4 PE=2 SV=1
19	Q92EU6	3.22e-30	114	254	0.338	0.315	GOLD_LISIN NAD-dependent glycerol dehydrogenase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=golD PE=1 SV=1
20	P50199	3.94e-30	114	256	0.329	0.305	GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=gno PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	1.9e-52	189.1	short chain dehydrogenase
2	PF13561 adh_short_C2	2.2e-58	209.2	Enoyl-(Acyl carrier protein) reductase
3	PF01370 Epimerase	1.3e+02	13.5	NAD dependent epimerase/dehydratase family
4	PF08323 Glyco_transf_5	48	15.1	Starch synthase catalytic domain
5	PF08659 KR	1.2e-11	56.3	KR domain
6	PF13460 NAD_binding_10	1.1	20.6	NAD(P)H-binding
7	PF03435 Sacchrp_dh_NADP	0.52	22.0	Saccharopine dehydrogenase NADP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363794	0.997	Estradiol 17-beta-dehydrogenase 8
2	9606.ENSP00000280701	0.979	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
3	9606.ENSP00000481593	0.917	Hydroxyacyl-thioester dehydratase type 2, mitochondrial
4	9606.ENSP00000304592	0.914	Fatty acid synthase
5	9606.ENSP00000290429	0.848	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
6	9606.ENSP00000290354	0.827	Carbonyl reductase [NADPH] 3
7	9606.ENSP00000379704	0.815	Neuronal-specific septin-3
8	9606.ENSP00000263702	0.798	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
9	9606.ENSP00000290349	0.715	Carbonyl reductase [NADPH] 1
10	9606.ENSP00000215565	0.698	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
11	9606.ENSP00000364649	0.656	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
12	9606.ENSP00000357535	0.654	Enoyl-CoA hydratase, mitochondrial
13	9606.ENSP00000358059	0.644	Reticulon-4-interacting protein 1, mitochondrial
14	9606.ENSP00000265395	0.641	3-hydroxyisobutyrate dehydrogenase, mitochondrial
15	9606.ENSP00000356953	0.636	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
16	9606.ENSP00000325562	0.621	MICOS complex subunit MIC10
17	9606.ENSP00000301329	0.616	Glyoxalase domain containing 4
18	9606.ENSP00000322991	0.614	Branched-chain-amino-acid aminotransferase, mitochondrial
19	9606.ENSP00000325313	0.604	Microtubule-associated protein 1S
20	9606.ENSP00000426638	0.596	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.999	protein binding
GO:0043168	0.999	anion binding
GO:0003955	0.998	NAD(P)H dehydrogenase (quinone) activity
GO:0016747	0.997	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0050661	0.995	NADP binding
GO:0048038	0.991	quinone binding
GO:0004312	0.985	fatty acid synthase activity
GO:0070402	0.984	NADPH binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.997	organic substance metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0006629	0.992	lipid metabolic process
GO:0044283	0.991	small molecule biosynthetic process
GO:0032787	0.988	monocarboxylic acid metabolic process
GO:1901576	0.972	organic substance biosynthetic process
GO:0072330	0.927	monocarboxylic acid biosynthetic process
GO:0006631	0.864	fatty acid metabolic process
GO:0006633	0.704	fatty acid biosynthetic process
GO:0006807	0.423	nitrogen compound metabolic process
GO:0071840	0.309	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0032991	0.987	protein-containing complex
GO:0005759	0.960	mitochondrial matrix
GO:1990204	0.823	oxidoreductase complex
GO:0016020	0.603	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.6.5.2	0.998	NAD(P)H dehydrogenase (quinone).
EC:2.3.1.-	0.997	Transferring groups other than amino-acyl groups.
RHEA:14993	0.985	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	0.985	fatty-acid synthase system.

[back to server]