StarFunc result for job id Q8N4V1

User Input

>input (131 residues)
MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGI
VHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTS
LKLRKLESLRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K273	0.498	0.498	9.758E-15	131	0.954	0.954	Q8K273.pdb.gz	EMC5_MOUSE ER membrane protein complex subunit 5 OS=Mus musculus OX=10090 GN=Mmgt1 PE=1 SV=1
2	PDB:6ww7E	0.464	0.595	7.768E-13	101	0.763	0.990	6ww7E.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
3	AFDB:Q8R3L0	0.495	0.526	1.869E-11	123	0.603	0.642	Q8R3L0.pdb.gz	MMGT2_MOUSE Membrane magnesium transporter 2 OS=Mus musculus OX=10090 GN=Mmgt2 PE=2 SV=1
4	AFDB:Q9VJ25	0.486	0.578	1.425E-8	109	0.420	0.505	Q9VJ25.pdb.gz	Q9VJ25_DROME Membrane magnesium transporter OS=Drosophila melanogaster OX=7227 GN=EMC5 PE=2 SV=1
5	AFDB:Q2HIM5	0.455	0.566	6.265E-4	104	0.221	0.279	Q2HIM5.pdb.gz	MMGT_ARATH Membrane magnesium transporter OS=Arabidopsis thaliana OX=3702 GN=At5g03345 PE=3 SV=1
6	AFDB:P40540	0.422	0.394	4.088E-2	141	0.168	0.156	P40540.pdb.gz	EMC5_YEAST ER membrane protein complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC5 PE=1 SV=1
7	AFDB:Q07451	0.286	0.191	4.223E-1	203	0.107	0.069	Q07451.pdb.gz	YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YET3 PE=1 SV=1
8	PDB:7ktxE	0.342	0.338	4.284E-1	133	0.183	0.180	7ktxE.pdb.gz	Structural and mechanistic basis of the EMC-dependent biogenesis of distinct transmembrane clients.
9	AFDB:C6Y4A7	0.420	0.509	1.200	106	0.122	0.151	C6Y4A7.pdb.gz	EMC5_SCHPO ER membrane protein complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emc5 PE=2 SV=1
10	AFDB:O34755	0.371	0.156	1.276	337	0.115	0.045	O34755.pdb.gz	YKOT_BACSU Uncharacterized glycosyltransferase YkoT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykoT PE=1 SV=1
11	AFDB:P30532	0.208	0.077	1.443	468	0.107	0.030	P30532.pdb.gz	ACHA5_HUMAN Neuronal acetylcholine receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=CHRNA5 PE=1 SV=2
12	AFDB:Q5AXA3	0.344	0.153	1.443	319	0.183	0.075	Q5AXA3.pdb.gz	Q5AXA3_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07077 PE=4 SV=1
13	PDB:5n9jZ	0.205	0.222	1.656	119	0.115	0.126	5n9jZ.pdb.gz
14	PDB:4qndA	0.190	0.248	1.760	97	0.076	0.103	4qndA.pdb.gz
15	PDB:1h7cA	0.253	0.309	1.991	103	0.084	0.107	1h7cA.pdb.gz
16	PDB:6wlwT	0.353	0.527	1.991	85	0.061	0.094	6wlwT.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
17	PDB:6ta5D	0.370	0.154	2.117	345	0.076	0.029	6ta5D.pdb.gz
18	PDB:1f4nA	0.326	0.659	2.251	59	0.046	0.102	1f4nA.pdb.gz	Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
19	PDB:1rprA	0.333	0.628	2.394	63	0.038	0.079	1rprA.pdb.gz
20	PDB:2wpdJ	0.240	0.359	2.545	76	0.069	0.118	2wpdJ.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N4V1	1.49e-95	272	131	1.000	1.000	EMC5_HUMAN ER membrane protein complex subunit 5 OS=Homo sapiens OX=9606 GN=MMGT1 PE=1 SV=1
2	Q8K273	9.67e-83	240	131	0.954	0.954	EMC5_MOUSE ER membrane protein complex subunit 5 OS=Mus musculus OX=10090 GN=Mmgt1 PE=1 SV=1
3	Q8R3L0	2.47e-50	158	123	0.634	0.675	MMGT2_MOUSE Membrane magnesium transporter 2 OS=Mus musculus OX=10090 GN=Mmgt2 PE=2 SV=1
4	Q9VJ25	3.98e-26	96.3	109	0.305	0.367	Q9VJ25_DROME Membrane magnesium transporter OS=Drosophila melanogaster OX=7227 GN=EMC5 PE=2 SV=1
5	Q2HIM5	2.35e-12	60.8	104	0.244	0.308	MMGT_ARATH Membrane magnesium transporter OS=Arabidopsis thaliana OX=3702 GN=At5g03345 PE=3 SV=1
6	P9WKA9	2.5	30.0	446	0.176	0.052	Y3371_MYCTU Putative diacyglycerol O-acyltransferase Rv3371 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3371 PE=1 SV=1
7	Q8NFT2	2.6	30.0	490	0.160	0.043	STEA2_HUMAN Metalloreductase STEAP2 OS=Homo sapiens OX=9606 GN=STEAP2 PE=1 SV=3
8	Q8BWB6	2.8	29.6	489	0.160	0.043	STEA2_MOUSE Metalloreductase STEAP2 OS=Mus musculus OX=10090 GN=Steap2 PE=1 SV=1
9	P35084	5.0	29.3	1727	0.130	0.010	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
10	P09208	5.7	28.9	2144	0.145	0.009	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
11	Q9NTG1	6.5	28.9	2253	0.130	0.008	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
12	P83111	7.4	28.5	547	0.099	0.024	LACTB_HUMAN Serine beta-lactamase-like protein LACTB, mitochondrial OS=Homo sapiens OX=9606 GN=LACTB PE=1 SV=2
13	E1ABP3	8.6	28.5	420	0.183	0.057	E1ABP3_ASPFM AfuFlbB beta OS=Aspergillus fumigatus OX=746128 GN=AfuflbB PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10270 MMgT	1.4e-11	55.9	Membrane magnesium transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010349806.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003927129.1	0.999	Belongs to the EMC3 family.
2	27679.XP_003933116.1	0.999	ER membrane protein complex subunit 6
3	27679.XP_003935807.1	0.999	ER membrane protein complex subunit 7
4	27679.XP_003935811.1	0.999	ER membrane protein complex subunit 4 isoform X1
5	27679.XP_003938638.1	0.999	ER membrane protein complex subunit 2
6	27679.XP_003940447.1	0.999	ER membrane protein complex subunit 10
7	27679.XP_003922869.1	0.996	ER membrane protein complex subunit 8 isoform X1
8	27679.XP_010343817.1	0.996	ER membrane protein complex subunit 1 isoform X2
9	27679.XP_003924341.1	0.995	ER membrane protein complex subunit 9
10	27679.XP_003924339.1	0.737	NEDD8
11	27679.XP_003926408.1	0.737	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 127 ESTs, 3 Proteins, and 84% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
12	27679.XP_010336984.1	0.689	Calcium-selective channel required to prevent calcium stores from overfilling
13	27679.XP_010329889.1	0.679	Guanine nucleotide-binding protein-like 3-like protein
14	27679.XP_003939278.1	0.677	Prefoldin subunit 5
15	27679.XP_010337226.1	0.677	Prefoldin subunit 5-like
16	27679.XP_010349669.1	0.677	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 16% coverage of the annotated genomic feature by RNAseq alignments
17	27679.XP_003933692.1	0.648	Magnesium transporter NIPA3 isoform X1
18	27679.XP_010348702.1	0.582	Transmembrane protein 52
19	27679.XP_010341087.1	0.578	Transmembrane protein 120B
20	27679.XP_010343740.1	0.571	NIPA-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140104	0.999	molecular carrier activity
GO:0015095	0.999	magnesium ion transmembrane transporter activity
GO:0032977	0.987	membrane insertase activity
GO:0005515	0.986	protein binding
GO:0046915	0.983	transition metal ion transmembrane transporter activity
GO:0005381	0.910	iron ion transmembrane transporter activity
GO:0015087	0.569	cobalt ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0090150	0.977	establishment of protein localization to membrane
GO:0010256	0.967	endomembrane system organization
GO:0007029	0.964	endoplasmic reticulum organization
GO:0045048	0.949	protein insertion into ER membrane
GO:0006810	0.740	transport
GO:0006812	0.416	monoatomic cation transport
GO:0055085	0.411	transmembrane transport
GO:0030001	0.392	metal ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0031090	1.000	organelle membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0071944	0.971	cell periphery
GO:0005886	0.959	plasma membrane
GO:0005789	0.955	endoplasmic reticulum membrane
GO:0098796	0.922	membrane protein complex
GO:0031982	0.876	vesicle
GO:0140534	0.856	endoplasmic reticulum protein-containing complex
GO:0072546	0.793	EMC complex
GO:0005794	0.629	Golgi apparatus
GO:0098588	0.615	bounding membrane of organelle
GO:0031410	0.590	cytoplasmic vesicle
GO:0005768	0.547	endosome
GO:0000139	0.445	Golgi membrane
GO:0005769	0.372	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29827	0.999	Mg(2+)(in) = Mg(2+)(out)
RHEA:28578	0.569	Co(2+)(in) = Co(2+)(out)

[back to server]