StarFunc result for job id Q8N4X5

User Input

>input (818 residues)
MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKV
TINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESP
EGYYEEAEPYDTSLNEDGEAVSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICA
FLWRKKWLGQWAKQLCVIKDNRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLK
ITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK
YLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPVERSLETSSYL
NVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQ
RKFSEPNTYIDGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDL
TPVKSFLHGPSSAQAQASSPTLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLES
LEPEDPSLRITTVKIQTEQQRISFPPSCPDAVVATPPGASPPVKDRLRVTSAEIKLGKNR
TEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETLLKCTDKEVLASLEQKLKEID
EECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENVSPRPKAVTPASAPD
CTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N4X5	1.000	1.000	0.000	818	1.000	1.000	Q8N4X5.pdb.gz	AF1L2_HUMAN Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2 PE=1 SV=1
2	AFDB:Q5DTU0	0.376	0.373	9.486E-102	825	0.834	0.827	Q5DTU0.pdb.gz	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
3	AFDB:E7FH23	0.333	0.320	2.784E-69	859	0.535	0.510	E7FH23.pdb.gz	E7FH23_DANRE Actin filament-associated protein 1-like 2 OS=Danio rerio OX=7955 GN=afap1l2 PE=4 SV=1
4	AFDB:A0A2R8QH80	0.293	0.291	1.641E-67	827	0.509	0.503	A0A2R8QH80.pdb.gz
5	AFDB:Q9Y4G2	0.117	0.092	1.984E-11	1056	0.084	0.065	Q9Y4G2.pdb.gz	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
6	AFDB:Q7TSI1	0.117	0.091	5.288E-10	1074	0.105	0.080	Q7TSI1.pdb.gz	PKHM1_MOUSE Pleckstrin homology domain-containing family M member 1 OS=Mus musculus OX=10090 GN=Plekhm1 PE=1 SV=1
7	PDB:3ljuX	0.108	0.225	4.983E-7	373	0.040	0.088	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	AFDB:E9PKC0	0.106	0.070	6.375E-7	1271	0.123	0.079	E9PKC0.pdb.gz	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
9	AFDB:P42331	0.128	0.159	6.375E-7	645	0.116	0.147	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
10	AFDB:J3KSW8	0.103	0.100	2.960E-6	844	0.127	0.123	J3KSW8.pdb.gz	J3KSW8_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
11	AFDB:P49796	0.108	0.086	1.791E-5	1198	0.133	0.091	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
12	PDB:6bbpA	0.108	0.166	3.828E-5	520	0.021	0.033	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
13	PDB:7c3mA	0.099	0.136	1.104E-4	577	0.054	0.076	7c3mA.pdb.gz
14	PDB:4mk0A	0.106	0.136	1.599E-4	631	0.021	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6u3eA	0.105	0.208	3.182E-4	397	0.021	0.043	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:3uzsA	0.104	0.138	1.643E-3	609	0.022	0.030	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
17	PDB:7rx9A	0.098	0.180	2.509E-3	432	0.024	0.046	7rx9A.pdb.gz
18	PDB:4uudC	0.102	0.608	6.507E-3	113	0.013	0.097	4uudC.pdb.gz
19	PDB:4mt6A	0.104	0.208	8.042E-3	389	0.018	0.039	4mt6A.pdb.gz
20	PDB:7nkyQ	0.086	0.157	8.479E-3	404	0.040	0.082	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FH23	0.0	733	859	0.539	0.513	E7FH23_DANRE Actin filament-associated protein 1-like 2 OS=Danio rerio OX=7955 GN=afap1l2 PE=4 SV=1
2	Q5DTU0	0.0	1381	825	0.835	0.828	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
3	Q8N4X5	0.0	1667	818	1.000	1.000	AF1L2_HUMAN Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2 PE=1 SV=1
4	Q8N556	1.34e-93	311	730	0.249	0.279	AFAP1_HUMAN Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2
5	Q90738	8.18e-93	309	729	0.244	0.274	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
6	Q8VH46	8.13e-86	290	731	0.247	0.276	AFAP1_RAT Actin filament-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Afap1 PE=1 SV=1
7	Q8BZI0	2.48e-85	290	768	0.253	0.270	AF1L1_MOUSE Actin filament-associated protein 1-like 1 OS=Mus musculus OX=10090 GN=Afap1l1 PE=1 SV=1
8	Q8TED9	2.97e-82	281	768	0.249	0.266	AF1L1_HUMAN Actin filament-associated protein 1-like 1 OS=Homo sapiens OX=9606 GN=AFAP1L1 PE=1 SV=2
9	O94887	0.069	39.3	1054	0.032	0.025	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
10	Q8IID2	0.072	39.3	2265	0.033	0.012	Q8IID2_PLAF7 Calcium-dependent protein kinase 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1123100 PE=3 SV=1
11	Q385G7	0.12	36.6	164	0.033	0.165	Q385G7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3830 PE=4 SV=1
12	Q8CIB5	0.13	38.1	680	0.039	0.047	FERM2_MOUSE Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1
13	Q54WI0	0.15	38.1	1333	0.034	0.021	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
14	Q91VS8	0.23	37.7	1065	0.035	0.027	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
15	B6RSP1	0.37	37.0	1197	0.027	0.018	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
16	Q8IDX6	0.45	36.6	3130	0.033	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
17	P42331	0.47	36.6	645	0.029	0.037	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
18	Q6ZPK1	0.63	36.2	1205	0.029	0.020	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
19	E9Q6H8	0.69	36.2	1269	0.029	0.019	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
20	B4DJX4	0.90	35.8	977	0.027	0.023	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11932 DUF3450	71	14.2	Protein of unknown function (DUF3450)
2	PF00169 PH	3.4e-15	67.8	PH domain
3	PF15413 PH_11	0.083	24.7	Pleckstrin homology domain
4	PF09371 Tex_N	6.3e+02	11.4	Tex-like protein N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428056	0.954	Phosphatidylinositol 3-kinase regulatory subunit alpha
2	9606.ENSP00000362680	0.912	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000348215	0.794	SH3 and PX domain-containing protein 2A
4	9606.ENSP00000337825	0.704	Tyrosine-protein kinase Lck
5	9606.ENSP00000393987	0.691	Protein FAM19A2
6	9606.ENSP00000220003	0.679	Tyrosine-protein kinase CSK
7	9606.ENSP00000482760	0.595	Proprotein convertase subtilisin/kexin type 6
8	9606.ENSP00000276603	0.547	Telomeric repeat-binding factor 1
9	9606.ENSP00000442982	0.528	Uracil nucleotide/cysteinyl leukotriene receptor
10	9606.ENSP00000347942	0.520	Proto-oncogene tyrosine-protein kinase receptor Ret

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042169	0.985	SH2 domain binding
GO:0017124	0.983	SH3 domain binding
GO:0098772	0.952	molecular function regulator activity
GO:0030234	0.918	enzyme regulator activity
GO:0140677	0.916	molecular function activator activity
GO:0008047	0.902	enzyme activator activity
GO:0030296	0.893	protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0048583	0.974	regulation of response to stimulus
GO:0048584	0.954	positive regulation of response to stimulus
GO:0023056	0.953	positive regulation of signaling
GO:0009967	0.936	positive regulation of signal transduction
GO:0051239	0.919	regulation of multicellular organismal process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0080090	0.917	regulation of primary metabolic process
GO:0009889	0.915	regulation of biosynthetic process
GO:0009893	0.907	positive regulation of metabolic process
GO:0051171	0.903	regulation of nitrogen compound metabolic process
GO:0050896	0.900	response to stimulus
GO:0010604	0.888	positive regulation of macromolecule metabolic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0010556	0.885	regulation of macromolecule biosynthetic process
GO:0010468	0.878	regulation of gene expression
GO:1901184	0.876	regulation of ERBB signaling pathway
GO:0031325	0.876	positive regulation of cellular metabolic process
GO:0051173	0.874	positive regulation of nitrogen compound metabolic process
GO:0019219	0.868	regulation of nucleobase-containing compound metabolic process
GO:0051240	0.853	positive regulation of multicellular organismal process
GO:0009987	0.811	cellular process
GO:0006950	0.698	response to stress
GO:0001817	0.643	regulation of cytokine production
GO:0032675	0.626	regulation of interleukin-6 production
GO:0009891	0.537	positive regulation of biosynthetic process
GO:0032502	0.506	developmental process
GO:0048856	0.499	anatomical structure development
GO:0008152	0.494	metabolic process
GO:1901186	0.482	positive regulation of ERBB signaling pathway
GO:0032677	0.456	regulation of interleukin-8 production
GO:0051252	0.451	regulation of RNA metabolic process
GO:0042058	0.438	regulation of epidermal growth factor receptor signaling pathway
GO:0032501	0.437	multicellular organismal process
GO:0010628	0.437	positive regulation of gene expression
GO:0010557	0.434	positive regulation of macromolecule biosynthetic process
GO:0045935	0.424	positive regulation of nucleobase-containing compound metabolic process
GO:0071704	0.418	organic substance metabolic process
GO:0031328	0.366	positive regulation of cellular biosynthetic process
GO:2001141	0.359	regulation of RNA biosynthetic process
GO:0044238	0.316	primary metabolic process
GO:0044237	0.305	cellular metabolic process
GO:0006807	0.304	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.998	cytosol
GO:0043229	0.806	intracellular organelle
GO:0043227	0.399	membrane-bounded organelle
GO:0043231	0.384	intracellular membrane-bounded organelle
GO:0043232	0.340	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]