StarFunc result for job id Q8N543

User Input

>input (542 residues)
MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDP
FLHCVIPNFIQSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILF
EDFRSWLSDISKIDLESTIDMSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSMGG
TLDLYSIDEHFQPKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGP
SLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLK
PEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNF
TGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPE
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTS
YIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIY
YE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N543	1.000	1.000	0.000	542	1.000	1.000	Q8N543.pdb.gz	OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1
2	AFDB:A0A0A0MTR2	0.442	0.479	3.364E-90	499	0.915	0.994	A0A0A0MTR2.pdb.gz	A0A0A0MTR2_HUMAN 2-oxoglutarate and iron dependent oxygenase domain containing 1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1
3	PDB:4nhyA	0.842	0.988	4.187E-89	461	0.851	1.000	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
4	AFDB:Q9I7H9	0.754	0.762	8.861E-43	536	0.264	0.267	Q9I7H9.pdb.gz	OGFD1_DROME Prolyl 3-hydroxylase sudestada1 OS=Drosophila melanogaster OX=7227 GN=sud1 PE=2 SV=1
5	AFDB:Q01F03	0.678	0.713	3.559E-35	514	0.256	0.270	Q01F03.pdb.gz	OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri OX=70448 GN=Ogd PE=1 SV=1
6	AFDB:Q11120	0.694	0.728	3.908E-33	515	0.247	0.260	Q11120.pdb.gz	OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ofd1 PE=1 SV=1
7	PDB:3kt4A	0.615	0.593	7.130E-31	563	0.240	0.231	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
8	AFDB:P40032	0.627	0.533	6.290E-30	644	0.242	0.203	P40032.pdb.gz	TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPA1 PE=1 SV=1
9	PDB:3mguA	0.626	0.636	1.045E-29	533	0.225	0.229	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
10	PDB:6nieA	0.271	0.545	5.999E-6	244	0.057	0.127	6nieA.pdb.gz	A family of radical halogenases for the engineering of amino-acid-based products.
11	PDB:7vjvA	0.227	0.498	9.925E-6	221	0.059	0.145	7vjvA.pdb.gz	Structural insights into the interactions and epigenetic functions of human nucleic acid repair protein ALKBH6.
12	PDB:7e38A	0.207	0.325	2.716E-5	313	0.059	0.102	7e38A.pdb.gz	Mechanistic analysis of carbon-carbon bond formation by deoxypodophyllotoxin synthase.
13	PDB:6fxrA	0.243	0.192	8.793E-5	700	0.048	0.037	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:4e2qA	0.148	0.282	1.230E-4	258	0.059	0.124	4e2qA.pdb.gz	Structural and functional insights into (S)-ureidoglycine aminohydrolase, key enzyme of purine catabolism in Arabidopsis thaliana
15	PDB:4qkbA	0.228	0.572	1.376E-4	190	0.055	0.158	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
16	AFDB:Q3TSG4	0.201	0.263	2.026E-4	395	0.074	0.101	Q3TSG4.pdb.gz	ALKB5_MOUSE RNA demethylase ALKBH5 OS=Mus musculus OX=10090 GN=Alkbh5 PE=1 SV=2
17	AFDB:F4HWB0	0.230	0.209	2.266E-4	601	0.068	0.062	F4HWB0.pdb.gz	F4HWB0_ARATH Hydroxyproline-rich glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=At1g14710 PE=1 SV=1
18	PDB:3fz3B	0.132	0.165	2.692E-4	410	0.085	0.112	3fz3B.pdb.gz	Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.
19	AFDB:Q08BA6	0.195	0.278	4.689E-4	352	0.057	0.088	Q08BA6.pdb.gz	ALKB5_DANRE RNA demethylase ALKBH5 OS=Danio rerio OX=7955 GN=alkbh5 PE=1 SV=1
20	AFDB:Q9C8I6	0.100	0.068	1.127E-1	894	0.020	0.012	Q9C8I6.pdb.gz	IOS1_ARATH LRR receptor-like serine/threonine-protein kinase IOS1 OS=Arabidopsis thaliana OX=3702 GN=IOS1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MTR2	0.0	1012	499	0.921	1.000	A0A0A0MTR2_HUMAN 2-oxoglutarate and iron dependent oxygenase domain containing 1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1
2	Q8N543	0.0	1121	542	1.000	1.000	OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1
3	Q9I7H9	1.14e-45	170	536	0.277	0.280	OGFD1_DROME Prolyl 3-hydroxylase sudestada1 OS=Drosophila melanogaster OX=7227 GN=sud1 PE=2 SV=1
4	Q01F03	1.90e-30	127	514	0.203	0.214	OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri OX=70448 GN=Ogd PE=1 SV=1
5	Q11120	4.79e-26	114	515	0.181	0.190	OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ofd1 PE=1 SV=1
6	P40032	1.66e-19	94.4	644	0.181	0.152	TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPA1 PE=1 SV=1
7	A0A8I6A4L5	2.9	33.1	976	0.035	0.019	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
8	H0VCR8	2.9	33.1	984	0.035	0.019	H0VCR8_CAVPO HECT-type E3 ubiquitin transferase OS=Cavia porcellus OX=10141 GN=NEDD4L PE=4 SV=2
9	D7NIW0	3.0	33.1	968	0.035	0.020	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
10	Q96PU5	3.0	33.1	975	0.035	0.019	NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2
11	A0A8I6GLU0	3.1	33.1	956	0.035	0.020	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
12	P05791	3.2	33.1	616	0.030	0.026	ILVD_ECOLI Dihydroxy-acid dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=ilvD PE=1 SV=5
13	A0A8I6AIV5	3.3	33.1	872	0.035	0.022	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
14	A0A8I6GL04	3.3	33.1	912	0.035	0.021	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
15	Q8CFI0	3.3	33.1	1004	0.035	0.019	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2
16	Q5T0N1	3.4	33.1	1121	0.039	0.019	CFA70_HUMAN Cilia- and flagella-associated protein 70 OS=Homo sapiens OX=9606 GN=CFAP70 PE=1 SV=3
17	Q5AYI6	3.6	32.7	787	0.057	0.039	BIODA_EMENI Bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bioDA PE=1 SV=1
18	Q8TZH8	4.0	32.7	764	0.039	0.027	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
19	Q586I1	4.3	32.7	819	0.050	0.033	Q586I1_TRYB2 Transmembrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.330 PE=4 SV=1
20	Q72FZ5	5.5	32.3	511	0.039	0.041	Q72FZ5_DESVH GTPase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0068 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13640 2OG-FeII_Oxy_3	2.1e-13	62.3	2OG-Fe(II) oxygenase superfamily
2	PF13661 2OG-FeII_Oxy_4	4.9e-39	144.1	2OG-Fe(II) oxygenase superfamily
3	PF10637 Ofd1_CTDD	8.8e-38	141.7	Oxoglutarate and iron-dependent oxygenase degradation C-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296674	0.898	40S ribosomal protein S23
2	9606.ENSP00000313007	0.795	Polyadenylate-binding protein 1
3	9606.ENSP00000380544	0.790	2-oxoglutarate and iron dependent oxygenase domain containing 2
4	9606.ENSP00000245564	0.717	Protein misato homolog 1
5	9606.ENSP00000302562	0.714	HSPB1-associated protein 1
6	9606.ENSP00000372955	0.714	Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
7	9606.ENSP00000351380	0.711	Translation machinery associated 16 homolog
8	9606.ENSP00000220809	0.702	Tissue-type plasminogen activator
9	9606.ENSP00000300648	0.700	eIF-2-alpha kinase activator GCN1
10	9606.ENSP00000341422	0.683	Transmembrane prolyl 4-hydroxylase
11	9606.ENSP00000477507	0.671	Ribosomal oxygenase 1
12	9606.ENSP00000340329	0.657	Caprin-1
13	9606.ENSP00000345917	0.646	Cell growth-regulating nucleolar protein
14	9606.ENSP00000328251	0.643	Ribosomal oxygenase 2
15	9606.ENSP00000355720	0.621	JmjC domain-containing protein 4
16	9606.ENSP00000466967	0.621	tRNA (guanine(26)-N(2))-dimethyltransferase
17	9606.ENSP00000341657	0.617	Thymocyte nuclear protein 1
18	9606.ENSP00000398410	0.606	JmjC domain-containing protein 5
19	9606.ENSP00000175506	0.602	Asparagine synthetase
20	9606.ENSP00000219169	0.601	Nuclear transport factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031543	1.000	peptidyl-proline dioxygenase activity
GO:0031544	0.981	peptidyl-proline 3-dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0009987	0.993	cellular process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0010556	0.986	regulation of macromolecule biosynthetic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0010468	0.985	regulation of gene expression
GO:0071840	0.983	cellular component organization or biogenesis
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0043412	0.977	macromolecule modification
GO:0043244	0.977	regulation of protein-containing complex disassembly
GO:0006417	0.973	regulation of translation
GO:0019538	0.968	protein metabolic process
GO:0070925	0.958	organelle assembly
GO:0140694	0.952	non-membrane-bounded organelle assembly
GO:0036211	0.937	protein modification process
GO:0034063	0.933	stress granule assembly
GO:0018126	0.910	protein hydroxylation
GO:0008283	0.888	cell population proliferation
GO:0018208	0.853	peptidyl-proline modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0099080	0.763	supramolecular complex
GO:0036464	0.736	cytoplasmic ribonucleoprotein granule
GO:0010494	0.708	cytoplasmic stress granule
GO:0012505	0.390	endomembrane system
GO:0016020	0.301	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]