StarFunc result for job id Q8N556

User Input

>input (730 residues)
MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLP
APPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSS
SYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCYKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQW
LKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGVVENGITTCNGKE
QVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGYLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAV
LEASSSEDMGRWIGILLAETGSSTDPEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISA
NPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSNAAQYKYGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIE
VNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPK
SGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLKKSQAAPGSSPCRGHVLRK
AKEWELKNGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VH46	0.305	0.305	2.150E-91	731	0.907	0.906	Q8VH46.pdb.gz	AFAP1_RAT Actin filament-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Afap1 PE=1 SV=1
2	AFDB:Q90738	0.602	0.603	5.369E-89	729	0.879	0.881	Q90738.pdb.gz	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
3	AFDB:E7FH23	0.245	0.214	1.253E-47	859	0.375	0.319	E7FH23.pdb.gz	E7FH23_DANRE Actin filament-associated protein 1-like 2 OS=Danio rerio OX=7955 GN=afap1l2 PE=4 SV=1
4	PDB:3ljuX	0.116	0.223	7.207E-7	373	0.049	0.097	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
5	AFDB:Q00IB7	0.123	0.065	7.545E-7	1433	0.086	0.044	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
6	AFDB:J3KSW8	0.128	0.112	1.564E-6	844	0.108	0.094	J3KSW8.pdb.gz	J3KSW8_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
7	AFDB:Q9P227	0.122	0.064	2.030E-6	1491	0.144	0.070	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
8	AFDB:A0A140LH27	0.123	0.056	4.433E-6	1664	0.073	0.032	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
9	AFDB:P34288	0.129	0.063	2.890E-5	1605	0.142	0.065	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
10	PDB:6bbpA	0.121	0.167	7.048E-5	520	0.033	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
11	AFDB:Q99KW3	0.133	0.051	8.190E-5	2014	0.149	0.054	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
12	PDB:4mk0A	0.123	0.142	1.126E-4	631	0.026	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	AFDB:Q5AWT0	0.064	0.049	1.179E-4	1050	0.119	0.083	Q5AWT0.pdb.gz	Q5AWT0_EMENI Sodium ion/proton exchanger (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07250 PE=3 SV=1
14	PDB:6u3eA	0.109	0.196	2.591E-4	397	0.032	0.058	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:7c3mA	0.119	0.143	3.192E-4	577	0.060	0.076	7c3mA.pdb.gz
16	PDB:6hhgA	0.115	0.208	6.281E-4	386	0.025	0.047	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:4mt6A	0.117	0.212	1.114E-3	389	0.019	0.036	4mt6A.pdb.gz
18	PDB:6s9wA	0.110	0.189	1.445E-3	411	0.019	0.034	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:7rx9A	0.113	0.185	1.445E-3	432	0.037	0.062	7rx9A.pdb.gz
20	PDB:6xtbE	0.105	0.281	1.690E-3	235	0.044	0.136	6xtbE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BZI0	0.0	549	768	0.481	0.457	AF1L1_MOUSE Actin filament-associated protein 1-like 1 OS=Mus musculus OX=10090 GN=Afap1l1 PE=1 SV=1
2	Q8N556	0.0	1492	730	1.000	1.000	AFAP1_HUMAN Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2
3	Q8TED9	0.0	548	768	0.481	0.457	AF1L1_HUMAN Actin filament-associated protein 1-like 1 OS=Homo sapiens OX=9606 GN=AFAP1L1 PE=1 SV=2
4	Q8VH46	0.0	1274	731	0.908	0.907	AFAP1_RAT Actin filament-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Afap1 PE=1 SV=1
5	Q90738	0.0	1244	729	0.879	0.881	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
6	Q5DTU0	1.49e-106	345	825	0.279	0.247	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
7	Q8N4X5	2.50e-105	342	818	0.295	0.263	AF1L2_HUMAN Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2 PE=1 SV=1
8	E7FH23	1.05e-94	315	859	0.249	0.212	E7FH23_DANRE Actin filament-associated protein 1-like 2 OS=Danio rerio OX=7955 GN=afap1l2 PE=4 SV=1
9	Q91VS8	1.19e-05	51.2	1065	0.073	0.050	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
10	Q9Y4F1	4.87e-05	49.3	1045	0.063	0.044	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
11	O94887	1.33e-04	47.8	1054	0.051	0.035	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
12	O88387	2.00e-04	47.4	766	0.044	0.042	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
13	Q91ZT5	4.07e-04	46.2	766	0.042	0.040	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
14	F1LYQ8	4.99e-04	46.2	1049	0.045	0.031	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
15	Q9Y2H5	5.20e-04	45.8	1048	0.034	0.024	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
16	Q96M96	0.001	44.7	766	0.044	0.042	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
17	E9QIC8	0.002	44.3	1025	0.049	0.035	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
18	Q96WV2	0.004	42.4	339	0.032	0.068	YJO2_SCHPO Uncharacterized PH domain-containing protein PB16A4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCPB16A4.02c PE=4 SV=2
19	Q9VCQ6	0.018	40.8	828	0.029	0.025	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
20	Q8T0R1	0.021	40.8	767	0.048	0.046	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03961 FapA	8.4e+02	11.0	Flagellar Assembly Protein A beta solenoid domain
2	PF18210 Knl1_RWD_C	26	16.5	Knl1 RWD C-terminal domain
3	PF00169 PH	5e-23	93.0	PH domain
4	PF15413 PH_11	0.031	26.1	Pleckstrin homology domain
5	PF20399 PH_20	4.3e+02	12.4	PH domain
6	PF15410 PH_9	47	15.6	Pleckstrin homology domain
7	PF16764 Sharpin_PH	3.4	18.9	Sharpin PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000012091

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009855	0.795	Tyrosine-protein kinase
2	60711.ENSCSAP00000003458	0.692	Uncharacterized protein
3	60711.ENSCSAP00000013643	0.666	Tyrosine-protein kinase
4	60711.ENSCSAP00000015107	0.638	Transmembrane protein 263
5	60711.ENSCSAP00000006988	0.603	Calcium-selective channel required to prevent calcium stores from overfilling
6	60711.ENSCSAP00000009573	0.574	Nischarin
7	60711.ENSCSAP00000012070	0.574	SH3 domain and tetratricopeptide repeats 1
8	60711.ENSCSAP00000014891	0.571	SIX homeobox 5
9	60711.ENSCSAP00000009417	0.558	Inter-alpha-trypsin inhibitor heavy chain 1
10	60711.ENSCSAP00000011158	0.558	Prostaglandin D2 receptor (DP)
11	60711.ENSCSAP00000006357	0.531	Growth arrest-specific 7
12	60711.ENSCSAP00000016563	0.531	Transforming growth factor, beta receptor III
13	60711.ENSCSAP00000009993	0.520	Ral GTPase activating protein, beta subunit (non-catalytic)
14	60711.ENSCSAP00000005615	0.519	Cortactin
15	60711.ENSCSAP00000001405	0.509	NHL repeat containing 2
16	60711.ENSCSAP00000016802	0.507	MutY DNA glycosylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042169	1.000	SH2 domain binding
GO:0017124	1.000	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0050896	0.981	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0044238	0.963	primary metabolic process
GO:0044237	0.962	cellular metabolic process
GO:0048583	0.950	regulation of response to stimulus
GO:0023051	0.948	regulation of signaling
GO:0010646	0.948	regulation of cell communication
GO:0006807	0.942	nitrogen compound metabolic process
GO:0016310	0.833	phosphorylation
GO:0043170	0.820	macromolecule metabolic process
GO:0009966	0.818	regulation of signal transduction
GO:0051716	0.798	cellular response to stimulus
GO:1901564	0.783	organonitrogen compound metabolic process
GO:0043412	0.766	macromolecule modification
GO:0018193	0.759	peptidyl-amino acid modification
GO:0009612	0.723	response to mechanical stimulus
GO:0006468	0.614	protein phosphorylation
GO:0007154	0.498	cell communication
GO:0018108	0.486	peptidyl-tyrosine phosphorylation
GO:0032501	0.433	multicellular organismal process
GO:0018195	0.427	peptidyl-arginine modification
GO:0104004	0.415	cellular response to environmental stimulus
GO:0032502	0.387	developmental process
GO:0071496	0.364	cellular response to external stimulus
GO:0023052	0.335	signaling
GO:0006950	0.332	response to stress
GO:0048856	0.311	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0043228	0.995	non-membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.992	cytosol
GO:0016020	0.977	membrane
GO:0015629	0.977	actin cytoskeleton
GO:0005886	0.974	plasma membrane
GO:0043227	0.940	membrane-bounded organelle
GO:0005925	0.908	focal adhesion
GO:0031982	0.866	vesicle
GO:0099080	0.450	supramolecular complex
GO:0005634	0.394	nucleus
GO:0099513	0.389	polymeric cytoskeletal fiber
GO:0005884	0.361	actin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]