StarFunc result for job id Q8N567

User Input

>input (271 residues)
MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKK
NKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKR
QAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGE
FPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGR
WAKGMSADYEEILDVPKPQKPKTKIPKVVNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAL5	0.683	0.683	1.154E-44	271	1.000	1.000	A0A024RAL5.pdb.gz
2	AFDB:Q9HFF2	0.324	0.382	2.001E-13	218	0.280	0.349	Q9HFF2.pdb.gz	YL92_SCHPO Uncharacterized protein C683.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC683.02c PE=4 SV=1
3	PDB:7c4cA	0.096	0.084	3.260E-3	332	0.100	0.081	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
4	AFDB:A0A1D5NSQ7	0.090	0.140	8.232E-1	169	0.092	0.148	A0A1D5NSQ7.pdb.gz
5	AFDB:Q7TQJ8	0.120	0.087	1.000	398	0.122	0.083	Q7TQJ8.pdb.gz	WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus OX=10090 GN=Wtip PE=1 SV=1
6	AFDB:P46600	0.125	0.120	1.216	282	0.111	0.106	P46600.pdb.gz	HAT1_ARATH Homeobox-leucine zipper protein HAT1 OS=Arabidopsis thaliana OX=3702 GN=HAT1 PE=1 SV=1
7	AFDB:Q94A03	0.135	0.099	1.297	391	0.048	0.033	Q94A03.pdb.gz	CDS4_ARATH Phosphatidate cytidylyltransferase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDS4 PE=1 SV=1
8	AFDB:O18400	0.112	0.075	1.384	509	0.181	0.096	O18400.pdb.gz	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
9	AFDB:P23812	0.115	0.116	1.576	268	0.085	0.086	P23812.pdb.gz	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
10	AFDB:P92953	0.083	0.075	1.916	318	0.111	0.094	P92953.pdb.gz	ATHB4_ARATH Homeobox-leucine zipper protein ATHB-4 OS=Arabidopsis thaliana OX=3702 GN=ATHB-4 PE=1 SV=1
11	AFDB:Q9ASQ2	0.134	0.121	1.916	309	0.081	0.071	Q9ASQ2.pdb.gz	MAMYB_ARATH Transcription factor MAMYB OS=Arabidopsis thaliana OX=3702 GN=MAMYB PE=1 SV=1
12	PDB:4kfzB	0.083	0.121	2.464	148	0.041	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:1vddA	0.080	0.103	4.719	199	0.048	0.065	1vddA.pdb.gz	Ring-shaped architecture of RecR: implications for its role in homologous recombinational DNA repair
14	PDB:7d5sRN	0.101	0.046	7.437	607	0.048	0.021	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:5dgesM	0.073	0.157	7.936	104	0.066	0.173	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
16	PDB:6qdvc	0.083	0.084	8.469	269	0.022	0.022	6qdvc.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
17	PDB:7dvqM	0.075	0.099	9.038	191	0.048	0.068	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N567	0.0	567	271	1.000	1.000	ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZCCHC9 PE=1 SV=2
2	Q9HFF2	7.33e-31	116	218	0.218	0.271	YL92_SCHPO Uncharacterized protein C683.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC683.02c PE=4 SV=1
3	Q38AZ9	1.04e-10	60.5	140	0.140	0.271	Q38AZ9_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0800 PE=4 SV=1
4	Q9GRG8	3.20e-09	56.2	140	0.137	0.264	Q9GRG8_9TRYP CCHC zinc finger protein OS=Trypanosoma brucei OX=5691 GN=ZFP PE=2 SV=1
5	Q59YJ9	4.04e-08	53.9	175	0.129	0.200	Q59YJ9_CANAL mRNA-binding translational activator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIS2 PE=4 SV=1
6	P53849	7.02e-08	52.8	153	0.125	0.222	GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1
7	O65639	1.58e-07	53.5	299	0.129	0.117	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
8	P36627	3.27e-07	51.6	179	0.114	0.173	BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr3 PE=4 SV=1
9	Q383X8	9.61e-06	48.9	516	0.107	0.056	Q383X8_TRYB2 Nucleic acid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1270 PE=4 SV=1
10	Q8T8R1	2.22e-05	45.8	165	0.125	0.206	CNBP_DROME CCHC-type zinc finger nucleic acid binding protein OS=Drosophila melanogaster OX=7227 GN=CNBP PE=1 SV=1
11	Q38B00	3.20e-05	46.2	213	0.107	0.136	Q38B00_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0820 PE=4 SV=1
12	Q966L9	1.00e-04	45.8	974	0.125	0.035	GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans OX=6239 GN=glh-2 PE=1 SV=1
13	Q65XV7	1.52e-04	45.4	951	0.085	0.024	RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1C PE=1 SV=1
14	P34689	1.92e-04	45.1	763	0.125	0.045	GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans OX=6239 GN=glh-1 PE=1 SV=3
15	P53996	3.82e-04	42.7	178	0.103	0.157	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
16	P62633	4.27e-04	42.4	177	0.103	0.158	CNBP_HUMAN CCHC-type zinc finger nucleic acid binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1
17	P62634	4.27e-04	42.4	177	0.103	0.158	CNBP_RAT CCHC-type zinc finger nucleic acid binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1
18	E7FCQ0	4.87e-04	42.0	161	0.133	0.224	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
19	J9VH01	0.001	42.7	1641	0.092	0.015	J9VH01_CRYNH CCHC-type domain-containing protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00520 PE=1 SV=1
20	Q12476	0.001	42.0	344	0.122	0.096	AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIR2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1.8e-11	54.7	Zinc knuckle
2	PF13696 zf-CCHC_2	0.059	24.5	Zinc knuckle
3	PF13917 zf-CCHC_3	6.5e+02	11.7	Zinc knuckle
4	PF14392 zf-CCHC_4	51	14.9	Zinc knuckle
5	PF14787 zf-CCHC_5	4.8e+02	11.9	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324124	0.792	DNA-directed RNA polymerases I, II, and III subunit RPABC5
2	9606.ENSP00000443113	0.689	Zinc finger CCHC-type containing 7
3	9606.ENSP00000264316	0.682	Tyrosine-protein kinase TXK
4	9606.ENSP00000245544	0.584	Nuclear pore complex protein Nup85
5	9606.ENSP00000244230	0.580	U3 small nucleolar ribonucleoprotein protein MPP10
6	9606.ENSP00000398655	0.580	Tyrosine-protein kinase ITK/TSK
7	9606.ENSP00000296582	0.579	Transmembrane protein 184C
8	9606.ENSP00000399415	0.564	Kynurenine--oxoglutarate transaminase 1
9	9606.ENSP00000410769	0.560	Cellular nucleic acid-binding protein
10	9606.ENSP00000230640	0.558	Superkiller viralicidic activity 2-like 2
11	9606.ENSP00000298130	0.558	Serine palmitoyltransferase small subunit A
12	9606.ENSP00000296632	0.555	StAR-related lipid transfer protein 4
13	9606.ENSP00000263239	0.531	ATP-dependent RNA helicase DDX18
14	9606.ENSP00000350224	0.522	Cytoplasmic tyrosine-protein kinase BMX
15	9606.ENSP00000471735	0.521	Probable protease (By similarity). Acts as a sensor of N(6)- methyladenosine methylation on DNA (m6A): recognizes and binds m6A DNA, leading to its degradation .
16	9606.ENSP00000420294	0.519	Polyhomeotic-like protein 3
17	9606.ENSP00000359292	0.509	SMC5-SMC6 complex localization factor protein 2
18	9606.ENSP00000484912	0.507	Calcyphosin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.997	protein binding
GO:0003677	0.710	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0016070	0.988	RNA metabolic process
GO:0065007	0.886	biological regulation
GO:0050789	0.867	regulation of biological process
GO:0034660	0.805	ncRNA metabolic process
GO:0006396	0.737	RNA processing
GO:0050794	0.673	regulation of cellular process
GO:0019222	0.485	regulation of metabolic process
GO:0060255	0.454	regulation of macromolecule metabolic process
GO:0032501	0.366	multicellular organismal process
GO:0031323	0.358	regulation of cellular metabolic process
GO:0080090	0.345	regulation of primary metabolic process
GO:0010468	0.336	regulation of gene expression
GO:0048518	0.329	positive regulation of biological process
GO:0051171	0.321	regulation of nitrogen compound metabolic process
GO:0032502	0.308	developmental process
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]