StarFunc result for job id Q8N573

User Input

>input (874 residues)
MTKDKNSPGLKKKSQSVDINAPGFNPLAGAGKQTPQASKPPAPKTPIIEEEQNNAANTQK
HPSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTP
NELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTNPDV
HPTEATPSSTFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNI
MFDPHKNDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCH
SKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQ
DKSSGASSESVQTVNQAEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEM
AIKEDQIADNFQGISGPKEDSTSIKGNSDQDSFLHENSLHQEESQKENMPCGETAEFKQK
QSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGH
IESSALLKEKQRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERT
DHLYAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETIEDSSNQAAAREWEVVSVAEY
HRRIDALNTEELRTLCRRLQITTREDINSKQVATVKADLESESFRPNLSDPSELLLPDQI
EKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALAS
EPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGD
LYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4KMM3	0.550	0.555	0.000	866	0.835	0.843	Q4KMM3.pdb.gz	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
2	AFDB:Q8N573	1.000	1.000	0.000	874	1.000	1.000	Q8N573.pdb.gz	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
3	AFDB:A2ACG1	0.194	0.846	2.304E-26	198	0.104	0.460	A2ACG1.pdb.gz	TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1
4	AFDB:Q7KTR8	0.199	0.638	9.132E-26	267	0.118	0.386	Q7KTR8.pdb.gz	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
5	PDB:7uneU	0.186	0.370	5.359E-14	427	0.061	0.124	7uneU.pdb.gz
6	PDB:7fdeP	0.183	0.837	1.801E-13	181	0.065	0.315	7fdeP.pdb.gz
7	AFDB:Q06681	0.053	0.042	4.584E-4	1438	0.138	0.084	Q06681.pdb.gz	YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSP2 PE=1 SV=1
8	AFDB:Q54I36	0.047	0.034	4.152E-3	1338	0.121	0.079	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
9	AFDB:P38800	0.061	0.047	8.497E-3	1345	0.124	0.080	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
10	PDB:5jceB	0.060	0.171	1.312E-2	297	0.019	0.057	5jceB.pdb.gz
11	AFDB:Q54DK4	0.050	0.036	3.974E-2	1352	0.124	0.080	Q54DK4.pdb.gz	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
12	AFDB:Q5VWT5	0.048	0.053	7.697E-2	728	0.108	0.129	Q5VWT5.pdb.gz	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
13	AFDB:Q9VED3	0.047	0.038	8.133E-2	1186	0.113	0.083	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
14	PDB:1lw3A	0.058	0.097	1.950E-1	513	0.010	0.018	1lw3A.pdb.gz
15	PDB:6e20B	0.065	0.278	1.950E-1	133	0.019	0.128	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.
16	PDB:6xtbE	0.057	0.199	3.202E-1	235	0.010	0.038	6xtbE.pdb.gz
17	PDB:7pubCJ	0.052	0.056	4.709E-1	803	0.014	0.015	7pubCJ.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:1jc9A	0.081	0.222	4.976E-1	220	0.015	0.059	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
19	PDB:7nkyQ	0.056	0.115	4.976E-1	404	0.006	0.012	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:5yqrA	0.058	0.178	5.555E-1	268	0.009	0.030	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4KMM3	0.0	1439	866	0.834	0.842	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
2	Q4V8B0	0.0	1269	839	0.751	0.782	OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3
3	Q8N573	0.0	1818	874	1.000	1.000	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
4	Q8NI08	5.03e-94	318	942	0.186	0.173	NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2
5	Q6DFV7	1.71e-91	311	943	0.184	0.171	NCOA7_MOUSE Nuclear receptor coactivator 7 OS=Mus musculus OX=10090 GN=Ncoa7 PE=1 SV=2
6	B7Z0T6	2.26e-69	247	789	0.149	0.165	B7Z0T6_DROME Mustard, isoform R OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
7	Q8IPN8	6.71e-69	247	869	0.149	0.150	Q8IPN8_DROME L82C OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
8	A0A0B4KF88	6.96e-69	247	871	0.149	0.149	A0A0B4KF88_DROME Mustard, isoform AA OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	Q8MSQ5	1.39e-68	249	1033	0.149	0.126	Q8MSQ5_DROME Mustard, isoform G OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
10	Q7KNC5	1.43e-68	248	1025	0.149	0.127	Q7KNC5_DROME L82B OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
11	Q9VNA1	1.54e-68	250	1270	0.149	0.102	Q9VNA1_DROME L82A OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=2
12	A0A0B4K699	1.58e-68	249	1158	0.149	0.112	A0A0B4K699_DROME Mustard, isoform Y OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
13	Q0KIB9	1.84e-68	250	1314	0.149	0.099	Q0KIB9_DROME Mustard, isoform P OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
14	B7Z0T3	1.94e-68	249	1106	0.149	0.118	B7Z0T3_DROME Mustard, isoform S OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
15	A4V2F2	2.50e-68	249	1246	0.149	0.104	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
16	Q4ABH3	2.57e-68	248	1012	0.149	0.128	Q4ABH3_DROME Mustard, isoform M OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
17	Q8IPN9	8.96e-68	246	1055	0.152	0.126	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
18	A0A0B4K620	1.65e-67	247	1344	0.152	0.099	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
19	Q9VNA2	1.73e-67	246	1127	0.152	0.118	Q9VNA2_DROME Mustard, isoform X OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=3
20	A0A0B4K6S8	1.93e-67	246	1180	0.152	0.113	A0A0B4K6S8_DROME Mustard, isoform W OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02893 GRAM	23	16.3	GRAM domain
2	PF01476 LysM	0.00027	32.2	LysM domain
3	PF07534 TLD	9.2e-35	131.3	TLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293330	0.862	Orexin
2	9606.ENSP00000384387	0.806	Orexin receptor type 1
3	9606.ENSP00000477548	0.737	Orexin receptor type 2
4	9606.ENSP00000432481	0.611	N-acetylated-alpha-linked acidic dipeptidase 2
5	9606.ENSP00000448310	0.586	Bestrophin-2
6	9606.ENSP00000379701	0.582	Hepatocyte nuclear factor 4-gamma
7	9606.ENSP00000366248	0.568	Cortistatin
8	9606.ENSP00000399511	0.568	TRAF2 and NCK-interacting protein kinase
9	9606.ENSP00000234396	0.555	V-type proton ATPase subunit B, kidney isoform
10	9606.ENSP00000439479	0.542	DmX-like protein 1
11	9606.ENSP00000446252	0.531	Superoxide dismutase [Mn], mitochondrial
12	9606.ENSP00000272645	0.527	DNA-directed RNA polymerase II subunit RPB4
13	9606.ENSP00000311713	0.523	Serine/threonine-protein kinase OSR1
14	9606.ENSP00000290663	0.507	Mediator of RNA polymerase II transcription subunit 8
15	9606.ENSP00000407375	0.503	Glutathione peroxidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.540	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0009987	0.881	cellular process
GO:0006950	0.874	response to stress
GO:0019222	0.760	regulation of metabolic process
GO:0080090	0.708	regulation of primary metabolic process
GO:0051171	0.708	regulation of nitrogen compound metabolic process
GO:0060255	0.660	regulation of macromolecule metabolic process
GO:0006979	0.586	response to oxidative stress
GO:0051716	0.550	cellular response to stimulus
GO:0048518	0.458	positive regulation of biological process
GO:0032501	0.448	multicellular organismal process
GO:0048522	0.443	positive regulation of cellular process
GO:0048583	0.424	regulation of response to stimulus
GO:0048519	0.338	negative regulation of biological process
GO:0042221	0.319	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0005730	0.995	nucleolus
GO:0005654	0.991	nucleoplasm
GO:0005739	0.821	mitochondrion
GO:0005829	0.742	cytosol
GO:0016020	0.671	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]