StarFunc result for job id Q8N5A5

User Input

>input (531 residues)
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
SLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE
EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD
VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE
KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL
ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5A5	1.000	1.000	1.536E-88	531	1.000	1.000	Q8N5A5.pdb.gz	ZGPAT_HUMAN Zinc finger CCCH-type with G patch domain-containing protein OS=Homo sapiens OX=9606 GN=ZGPAT PE=1 SV=3
2	AFDB:A0A0S2Z5X3	0.391	0.400	6.138E-80	511	0.962	1.000	A0A0S2Z5X3.pdb.gz	A0A0S2Z5X3_HUMAN Zinc finger CCCH-type with G patch domain-containing protein (Fragment) OS=Homo sapiens OX=9606 GN=ZGPAT PE=2 SV=1
3	AFDB:Q9ZVT1	0.164	0.137	1.002E-7	670	0.143	0.113	Q9ZVT1.pdb.gz	DUF1_ARATH DUF724 domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=DUF1 PE=2 SV=1
4	AFDB:F4IL23	0.158	0.125	2.000E-7	709	0.079	0.059	F4IL23.pdb.gz	F4IL23_ARATH Agenet domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DUF6 PE=1 SV=1
5	AFDB:A8MW92	0.103	0.055	1.417E-5	1017	0.109	0.057	A8MW92.pdb.gz	P20L1_HUMAN PHD finger protein 20-like protein 1 OS=Homo sapiens OX=9606 GN=PHF20L1 PE=1 SV=2
6	AFDB:A0A2R8QH80	0.100	0.070	6.710E-4	827	0.136	0.087	A0A2R8QH80.pdb.gz
7	AFDB:Q8N4X5	0.127	0.084	1.418E-3	818	0.151	0.098	Q8N4X5.pdb.gz	AF1L2_HUMAN Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2 PE=1 SV=1
8	AFDB:Q5DTU0	0.130	0.085	2.672E-3	825	0.128	0.082	Q5DTU0.pdb.gz	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
9	AFDB:Q3U9G9	0.103	0.089	5.034E-3	626	0.079	0.067	Q3U9G9.pdb.gz	LBR_MOUSE Delta(14)-sterol reductase LBR OS=Mus musculus OX=10090 GN=Lbr PE=1 SV=2
10	AFDB:B1AVB1	0.122	0.084	5.983E-3	825	0.107	0.069	B1AVB1.pdb.gz	B1AVB1_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
11	PDB:5datS4	0.081	0.144	6.501E-3	260	0.041	0.085	5datS4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:2ns2A	0.093	0.209	8.670E-3	201	0.043	0.114	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
13	PDB:3p8bB	0.093	0.300	2.742E-2	147	0.024	0.088	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
14	PDB:7okyZ	0.084	0.118	4.604E-2	374	0.021	0.029	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
15	PDB:7r1dC	0.093	0.247	5.166E-2	192	0.028	0.078	7r1dC.pdb.gz
16	PDB:7abi7	0.089	0.168	5.472E-2	236	0.043	0.097	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:6ta5D	0.093	0.135	1.031E-1	345	0.075	0.116	6ta5D.pdb.gz
18	PDB:7nkxZ	0.085	0.269	1.031E-1	156	0.019	0.064	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:1k9aB	0.081	0.096	1.092E-1	441	0.021	0.025	1k9aB.pdb.gz
20	PDB:4zn3A	0.096	0.323	1.157E-1	147	0.011	0.041	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5X3	0.0	1026	511	0.962	1.000	A0A0S2Z5X3_HUMAN Zinc finger CCCH-type with G patch domain-containing protein (Fragment) OS=Homo sapiens OX=9606 GN=ZGPAT PE=2 SV=1
2	A0A0S2Z6H0	0.0	1032	523	0.966	0.981	A0A0S2Z6H0_HUMAN Zinc finger CCCH-type with G patch domain-containing protein (Fragment) OS=Homo sapiens OX=9606 GN=ZGPAT PE=1 SV=1
3	Q8N5A5	0.0	1078	531	1.000	1.000	ZGPAT_HUMAN Zinc finger CCCH-type with G patch domain-containing protein OS=Homo sapiens OX=9606 GN=ZGPAT PE=1 SV=3
4	Q9UBB9	2.47e-07	55.8	837	0.043	0.027	TFP11_HUMAN Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1
5	Q9ERA6	2.89e-07	55.8	838	0.043	0.027	TFP11_MOUSE Tuftelin-interacting protein 11 OS=Mus musculus OX=10090 GN=Tfip11 PE=1 SV=1
6	Q9Y103	2.81e-06	52.8	839	0.043	0.027	TFP11_DROME Septin-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=sip1 PE=1 SV=1
7	O75940	9.81e-05	46.2	238	0.056	0.126	SPF30_HUMAN Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1
8	Q9SHG6	0.001	44.3	849	0.043	0.027	STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=STIPL1 PE=1 SV=1
9	Q9UTK6	0.001	44.3	797	0.041	0.028	YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1486.03c PE=3 SV=1
10	Q99KG3	0.003	42.7	930	0.049	0.028	RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus OX=10090 GN=Rbm10 PE=1 SV=1
11	A0A0S2Z4W4	0.004	42.7	930	0.049	0.028	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
12	A0A0S2Z4X1	0.004	42.7	852	0.049	0.031	A0A0S2Z4X1_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
13	P70501	0.004	42.4	852	0.049	0.031	RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus OX=10116 GN=Rbm10 PE=1 SV=1
14	P98175	0.004	42.7	930	0.049	0.028	RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3
15	Q06411	0.006	42.0	708	0.049	0.037	SP382_YEAST Pre-mRNA-splicing factor SPP382 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPP382 PE=1 SV=1
16	Q9NW75	0.006	41.6	528	0.036	0.036	GPTC2_HUMAN G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1
17	A2A6A1	0.009	41.6	1505	0.032	0.011	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
18	Q9UKJ3	0.009	41.2	1502	0.032	0.011	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2
19	Q8SZM4	0.014	40.8	1004	0.036	0.019	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
20	Q9SLC6	0.014	40.8	752	0.051	0.036	STIP2_ARATH Septin and tuftelin-interacting protein 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=STIPL2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16326 ABC_tran_CTD	58	15.4	ABC transporter C-terminal domain
2	PF01585 G-patch	1.3e-08	45.8	G-patch domain
3	PF06008 Laminin_I	13	17.0	Laminin Domain I
4	PF00642 zf-CCCH	0.8	21.0	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
5	PF14608 zf-CCCH_2	0.73	21.7	RNA-binding, Nab2-type zinc finger
6	PF18044 zf-CCCH_4	0.003	28.5	CCCH-type zinc finger
7	PF18345 zf_CCCH_4	0.012	26.9	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363313	0.773	U4/U6 small nuclear ribonucleoprotein Prp4
2	9606.ENSP00000315379	0.761	U4/U6 small nuclear ribonucleoprotein Prp3
3	9606.ENSP00000336741	0.736	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
4	9606.ENSP00000266068	0.721	Glucocorticoid modulatory element-binding protein 2
5	9606.ENSP00000483486	0.693	ADP-ribosylation factor-related protein 1
6	9606.ENSP00000266077	0.685	SLC2A4 regulator
7	9606.ENSP00000309521	0.668	Lck-interacting transmembrane adapter 1
8	9606.ENSP00000366876	0.640	PHD finger protein 13
9	9606.ENSP00000353332	0.639	Regulator of telomere elongation helicase 1
10	9606.ENSP00000480914	0.639	Fibronectin type III domain-containing protein 11
11	9606.ENSP00000369716	0.637	Chromodomain-helicase-DNA-binding protein 3
12	9606.ENSP00000393795	0.634	Zinc finger protein 512B
13	9606.ENSP00000234389	0.611	Glutamate receptor ionotropic, NMDA 3B
14	9606.ENSP00000347498	0.599	Abscission/NoCut checkpoint regulator
15	9606.ENSP00000401477	0.595	Transmembrane protein 232
16	9606.ENSP00000426906	0.595	Belongs to the RNase T2 family.
17	9606.ENSP00000369424	0.583	Histone-binding protein RBBP7
18	9606.ENSP00000245552	0.561	5'(3')-deoxyribonucleotidase, cytosolic type
19	9606.ENSP00000460348	0.554	Pre-mRNA-processing-splicing factor 8
20	9606.ENSP00000380514	0.551	Hydroxyacylglutathione hydrolase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.969	DNA binding
GO:0000981	0.958	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227	0.954	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.951	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.909	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003723	0.324	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0048523	0.977	negative regulation of cellular process
GO:0010605	0.967	negative regulation of macromolecule metabolic process
GO:0031324	0.963	negative regulation of cellular metabolic process
GO:0051248	0.959	negative regulation of protein metabolic process
GO:0048583	0.958	regulation of response to stimulus
GO:0042325	0.958	regulation of phosphorylation
GO:0050790	0.956	regulation of catalytic activity
GO:0031400	0.950	negative regulation of protein modification process
GO:0042326	0.950	negative regulation of phosphorylation
GO:0010469	0.946	regulation of signaling receptor activity
GO:0045859	0.946	regulation of protein kinase activity
GO:0050732	0.940	negative regulation of peptidyl-tyrosine phosphorylation
GO:0006355	0.937	regulation of DNA-templated transcription
GO:0061097	0.937	regulation of protein tyrosine kinase activity
GO:0042058	0.936	regulation of epidermal growth factor receptor signaling pathway
GO:1901185	0.933	negative regulation of ERBB signaling pathway
GO:0006357	0.919	regulation of transcription by RNA polymerase II
GO:0045934	0.900	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.892	negative regulation of RNA metabolic process
GO:0051348	0.887	negative regulation of transferase activity
GO:0033673	0.879	negative regulation of kinase activity
GO:0045892	0.877	negative regulation of DNA-templated transcription
GO:0006469	0.869	negative regulation of protein kinase activity
GO:0042059	0.861	negative regulation of epidermal growth factor receptor signaling pathway
GO:0009987	0.706	cellular process
GO:0071704	0.649	organic substance metabolic process
GO:0044238	0.504	primary metabolic process
GO:0006807	0.491	nitrogen compound metabolic process
GO:0043170	0.463	macromolecule metabolic process
GO:0000122	0.408	negative regulation of transcription by RNA polymerase II
GO:0044237	0.406	cellular metabolic process
GO:0034641	0.342	cellular nitrogen compound metabolic process
GO:1901360	0.341	organic cyclic compound metabolic process
GO:0090304	0.321	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	1.000	nucleoplasm
GO:0005737	0.386	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]