StarFunc result for job id Q8N5C8

User Input

>input (712 residues)
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5C8	0.999	0.999	1.041E-93	712	1.000	1.000	Q8N5C8.pdb.gz	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
2	AFDB:Q5U303	0.112	0.115	2.256E-28	693	0.381	0.391	Q5U303.pdb.gz	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2
3	AFDB:Q5RFW2	0.111	0.111	5.135E-23	711	0.354	0.354	Q5RFW2.pdb.gz	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
4	AFDB:M9PB92	0.077	0.054	6.603E-4	1062	0.145	0.097	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
5	AFDB:A0A087WYS3	0.067	0.047	7.498E-4	1087	0.152	0.099	A0A087WYS3.pdb.gz	A0A087WYS3_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=1
6	AFDB:P34333	0.057	0.027	9.669E-4	1778	0.139	0.056	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
7	AFDB:Q14241	0.079	0.073	2.210E-3	798	0.163	0.145	Q14241.pdb.gz	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
8	AFDB:Q86AD8	0.066	0.043	5.736E-3	1207	0.143	0.085	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
9	AFDB:Q63187	0.071	0.067	7.883E-3	773	0.162	0.149	Q63187.pdb.gz	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1
10	AFDB:Q6ZPK0	0.060	0.060	8.400E-3	688	0.156	0.161	Q6ZPK0.pdb.gz	PF21A_MOUSE PHD finger protein 21A OS=Mus musculus OX=10090 GN=Phf21a PE=1 SV=3
11	PDB:7r7jB	0.037	0.046	1.825	574	0.011	0.014	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
12	PDB:4f1iA	0.061	0.126	3.036	328	0.013	0.027	4f1iA.pdb.gz
13	PDB:7bhpLm	0.037	0.420	4.737	52	0.010	0.135	7bhpLm.pdb.gz	Dynamic association of human Ebp1 with the ribosome.
14	PDB:3j79f	0.036	0.361	5.733	51	0.011	0.157	3j79f.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
15	PDB:4xb6C	0.067	0.130	6.109	353	0.006	0.011	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
16	PDB:3ihpB	0.058	0.060	7.879	681	0.007	0.007	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
17	PDB:1olmE	0.061	0.106	8.396	397	0.010	0.018	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
18	PDB:3e46A	0.049	0.157	8.396	202	0.008	0.030	3e46A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5C8	0.0	1444	712	1.000	1.000	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
2	Q99K90	2.47e-116	367	693	0.412	0.423	TAB2_MOUSE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Mus musculus OX=10090 GN=Tab2 PE=1 SV=1
3	Q5U303	5.41e-116	366	693	0.409	0.420	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2
4	Q9NYJ8	9.89e-112	355	693	0.404	0.416	TAB2_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Homo sapiens OX=9606 GN=TAB2 PE=1 SV=1
5	Q5RFW2	4.96e-46	177	711	0.190	0.190	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
6	A0A0B4KG87	0.010	41.6	820	0.025	0.022	A0A0B4KG87_DROME TAK1-associated binding protein 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=4 SV=1
7	Q4TZQ4	0.010	41.6	831	0.025	0.022	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
8	Q6NQZ7	0.010	41.6	831	0.025	0.022	Q6NQZ7_DROME LD40663p OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
9	Q9NFL3	0.010	41.6	831	0.025	0.022	Q9NFL3_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
10	Q9S773	3.8	33.1	389	0.063	0.116	MYB97_ARATH Transcription factor MYB97 OS=Arabidopsis thaliana OX=3702 GN=MYB97 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	6.1e-07	40.3	CUE domain
2	PF00641 zf-RanBP	0.17	22.5	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216160	0.997	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
2	9606.ENSP00000358335	0.994	Mitogen-activated protein kinase kinase kinase 7
3	9606.ENSP00000433623	0.993	TNF receptor-associated factor 6
4	9606.ENSP00000355231	0.985	Beclin-1
5	9606.ENSP00000359424	0.973	Inhibitor of nuclear factor kappa-B kinase subunit alpha
6	9606.ENSP00000430684	0.972	Inhibitor of nuclear factor kappa-B kinase subunit beta
7	9606.ENSP00000441543	0.962	Polyubiquitin-C
8	9606.ENSP00000392025	0.953	Ubiquitin carboxyl-terminal hydrolase CYLD
9	9606.ENSP00000356426	0.938	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
10	9606.ENSP00000483825	0.936	NF-kappa-B essential modulator
11	9606.ENSP00000265560	0.935	Ubiquitin carboxyl-terminal hydrolase 4
12	9606.ENSP00000481570	0.934	Tumor necrosis factor alpha-induced protein 3
13	9606.ENSP00000462729	0.933	OTU domain-containing protein 7B
14	9606.ENSP00000345083	0.932	Dual specificity mitogen-activated protein kinase kinase 3
15	9606.ENSP00000259808	0.931	Receptor-interacting serine/threonine-protein kinase 1
16	9606.ENSP00000468348	0.931	Dual specificity mitogen-activated protein kinase kinase 6
17	9606.ENSP00000454207	0.926	TNF receptor-associated factor 3
18	9606.ENSP00000410402	0.925	Dual specificity mitogen-activated protein kinase kinase 4
19	9606.ENSP00000381070	0.919	Dual specificity mitogen-activated protein kinase kinase 7
20	9606.ENSP00000247668	0.917	TNF receptor-associated factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070530	1.000	K63-linked polyubiquitin modification-dependent protein binding
GO:0008270	1.000	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0043123	0.992	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0009892	0.945	negative regulation of metabolic process
GO:0009894	0.911	regulation of catabolic process
GO:0031324	0.871	negative regulation of cellular metabolic process
GO:0009895	0.867	negative regulation of catabolic process
GO:0031329	0.863	regulation of cellular catabolic process
GO:0010506	0.829	regulation of autophagy
GO:0031330	0.822	negative regulation of cellular catabolic process
GO:0010507	0.779	negative regulation of autophagy
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0050896	0.694	response to stimulus
GO:0009987	0.662	cellular process
GO:0051171	0.645	regulation of nitrogen compound metabolic process
GO:0080090	0.603	regulation of primary metabolic process
GO:0051716	0.518	cellular response to stimulus
GO:0009893	0.448	positive regulation of metabolic process
GO:0008152	0.366	metabolic process
GO:0023052	0.344	signaling
GO:0065009	0.334	regulation of molecular function
GO:0071704	0.330	organic substance metabolic process
GO:0007165	0.312	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0098588	0.996	bounding membrane of organelle
GO:0005768	0.996	endosome
GO:0030659	0.995	cytoplasmic vesicle membrane
GO:0010008	0.993	endosome membrane
GO:0005576	0.976	extracellular region
GO:0070062	0.950	extracellular exosome
GO:0005634	0.942	nucleus
GO:0070013	0.935	intracellular organelle lumen
GO:0031981	0.922	nuclear lumen
GO:0005654	0.882	nucleoplasm
GO:0043232	0.302	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]