StarFunc result for job id Q8N5D6

User Input

>input (347 residues)
MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQP
VVWSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGK
YTHFIQSFLESAEEFFMRGYRVHYYIFTDNPAAVPGVPLGPHRLLSSIPIQGHSHWEETS
MRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFP
YERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESH
LNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5D6	1.000	1.000	3.561E-77	347	1.000	1.000	Q8N5D6.pdb.gz	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
2	AFDB:Q95158	0.897	0.897	9.677E-66	347	0.836	0.836	Q95158.pdb.gz	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
3	AFDB:Q8VI38	0.897	0.897	2.043E-64	347	0.793	0.793	Q8VI38.pdb.gz	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
4	AFDB:B0B1U2	0.837	0.820	1.506E-45	354	0.441	0.432	B0B1U2.pdb.gz	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
5	AFDB:Q9ET32	0.836	0.834	1.250E-44	348	0.401	0.399	Q9ET32.pdb.gz	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
6	AFDB:Q8CFC4	0.810	0.841	2.809E-43	334	0.406	0.422	Q8CFC4.pdb.gz	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
7	PDB:4y63A	0.801	0.985	3.062E-43	282	0.412	0.507	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
8	AFDB:P38649	0.823	0.860	4.918E-43	332	0.398	0.416	P38649.pdb.gz	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
9	AFDB:A0A4Z3	0.767	0.785	4.349E-39	339	0.346	0.354	A0A4Z3.pdb.gz	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
10	AFDB:Q3V1N9	0.762	0.715	5.241E-39	370	0.352	0.330	Q3V1N9.pdb.gz	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
11	AFDB:Q3L7M0	0.767	0.718	7.614E-39	371	0.354	0.332	Q3L7M0.pdb.gz	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
12	PDB:1ll0B	0.366	0.455	3.511E-7	267	0.063	0.082	1ll0B.pdb.gz
13	PDB:8cvzI	0.384	0.473	8.392E-7	267	0.069	0.090	8cvzI.pdb.gz
14	PDB:6fxrA	0.372	0.199	1.564E-6	700	0.084	0.041	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
15	PDB:7jhiC	0.329	0.342	2.739E-5	331	0.055	0.057	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
16	PDB:2gamC	0.327	0.309	1.470E-4	374	0.089	0.083	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
17	PDB:7d72A	0.334	0.292	1.665E-4	407	0.069	0.059	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:4hg6A	0.306	0.155	2.136E-4	747	0.110	0.051	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
19	PDB:6iwqA	0.270	0.187	2.136E-4	546	0.098	0.062	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
20	PDB:1h5sB	0.327	0.376	3.740E-4	291	0.098	0.117	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5D6	0.0	722	347	1.000	1.000	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
2	Q8VI38	0.0	578	347	0.793	0.793	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
3	Q95158	0.0	605	347	0.836	0.836	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
4	B0B1U2	2.98e-98	296	354	0.418	0.410	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
5	P16442	2.51e-97	294	354	0.412	0.404	BGAT_HUMAN Histo-blood group ABO system transferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=2
6	Q8CFC4	3.12e-92	280	334	0.395	0.410	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
7	Q9ET32	1.22e-90	277	348	0.395	0.394	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
8	P38649	1.94e-90	276	332	0.392	0.410	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
9	Q3L7M0	7.18e-84	260	371	0.372	0.348	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
10	A0A4Z3	9.37e-74	233	339	0.346	0.354	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
11	Q3V1N9	1.03e-73	234	370	0.343	0.322	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
12	Q8WSV6	0.70	33.9	337	0.098	0.101	Q8WSV6_DICDI Alternative oxidase OS=Dictyostelium discoideum OX=44689 GN=aoxA PE=2 SV=1
13	O09008	2.0	32.7	321	0.063	0.069	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
14	Q62784	4.4	32.0	939	0.049	0.018	INP4A_RAT Inositol polyphosphate-4-phosphatase type I A OS=Rattus norvegicus OX=10116 GN=Inpp4a PE=1 SV=1
15	Q9EPW0	4.5	32.0	939	0.049	0.018	INP4A_MOUSE Inositol polyphosphate-4-phosphatase type I A OS=Mus musculus OX=10090 GN=Inpp4a PE=1 SV=1
16	P55268	5.2	31.6	1798	0.078	0.015	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
17	Q2TCH2	6.0	31.2	516	0.052	0.035	Q2TCH2_PIG Perilipin OS=Sus scrofa OX=9823 PE=2 SV=1
18	Q61292	8.6	30.8	1799	0.069	0.013	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
19	Q01635	9.7	30.4	303	0.066	0.076	LAMB1_CHICK Laminin subunit beta-1 (Fragment) OS=Gallus gallus OX=9031 GN=LAMB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13704 Glyco_tranf_2_4	54	15.8	Glycosyl transferase family 2
2	PF03414 Glyco_transf_6	9.8e-147	499.4	Glycosyltransferase family 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361110

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376532	0.967	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
2	9606.ENSP00000381699	0.946	Beta-1,3-galactosyltransferase 5
3	9606.ENSP00000261416	0.900	Beta-hexosaminidase subunit beta
4	9606.ENSP00000268097	0.900	Beta-hexosaminidase subunit alpha
5	9606.ENSP00000379680	0.875	Alpha-N-acetylgalactosaminidase
6	9606.ENSP00000361180	0.759	General transcription factor 3C polypeptide 5
7	9606.ENSP00000263736	0.668	S1 RNA-binding domain-containing protein 1
8	9606.ENSP00000290691	0.657	Ral-GDS-related protein
9	9606.ENSP00000362108	0.648	Neutrophil gelatinase-associated lipocalin
10	9606.ENSP00000422533	0.644	Adhesion G protein-coupled receptor L3
11	9606.ENSP00000388275	0.633	Cytosolic carboxypeptidase 3
12	9606.ENSP00000257118	0.620	Polyhomeotic-like protein 2
13	9606.ENSP00000384794	0.617	Lactosylceramide 4-alpha-galactosyltransferase
14	9606.ENSP00000295025	0.547	Proto-oncogene c-Rel
15	9606.ENSP00000344782	0.514	Zinc finger protein Gfi-1b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008376	1.000	acetylgalactosaminyltransferase activity
GO:0005488	0.941	binding
GO:0005515	0.892	protein binding
GO:0008378	0.841	galactosyltransferase activity
GO:0047277	0.451	globoside alpha-N-acetylgalactosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006629	0.997	lipid metabolic process
GO:0006643	0.990	membrane lipid metabolic process
GO:1901135	0.988	carbohydrate derivative metabolic process
GO:1903509	0.976	liposaccharide metabolic process
GO:0006664	0.934	glycolipid metabolic process
GO:0006807	0.693	nitrogen compound metabolic process
GO:1901564	0.562	organonitrogen compound metabolic process
GO:1901576	0.471	organic substance biosynthetic process
GO:1901137	0.352	carbohydrate derivative biosynthetic process
GO:0044249	0.323	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.966	endomembrane system
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005737	0.947	cytoplasm
GO:0005794	0.761	Golgi apparatus
GO:0031982	0.538	vesicle
GO:0031410	0.330	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:22164	0.451	globoside Gb4Cer (d18:1(4E)) + UDP-N-acetyl-alpha-D-galactosamine = globoside Forssman (d18:1(4E)) + H(+) + UDP
EC:2.4.1.88	0.451	globoside alpha-N-acetylgalactosaminyltransferase.

[back to server]