StarFunc result for job id Q8N5H3

User Input

>input (189 residues)
MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAAR
APDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQD
YKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQW
LQDAFHISL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q566R4	0.526	0.526	8.702E-27	189	0.963	0.963	Q566R4.pdb.gz	LRA25_RAT Leucine repeat adapter protein 25 OS=Rattus norvegicus OX=10116 GN=Fam89b PE=1 SV=1
2	AFDB:Q64321	0.184	0.078	2.038E-1	544	0.180	0.062	Q64321.pdb.gz	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
3	AFDB:Q8IRJ8	0.283	0.190	8.411E-1	288	0.122	0.080	Q8IRJ8.pdb.gz	THOC7_DROME THO complex protein 7 OS=Drosophila melanogaster OX=7227 GN=thoc7 PE=1 SV=2
4	AFDB:Q58G59	0.233	0.046	1.221	1363	0.153	0.021	Q58G59.pdb.gz	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
5	AFDB:Q9C9N3	0.226	0.157	1.221	310	0.164	0.100	Q9C9N3.pdb.gz	C3H14_ARATH Zinc finger CCCH domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=C3H14 PE=2 SV=1
6	AFDB:Q9SJJ3	0.189	0.072	1.316	584	0.143	0.046	Q9SJJ3.pdb.gz	BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana OX=3702 GN=BLH8 PE=1 SV=1
7	AFDB:P27705	0.259	0.108	2.390	504	0.153	0.058	P27705.pdb.gz	MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIG1 PE=1 SV=1
8	AFDB:Q8IDG8	0.234	0.303	2.575	137	0.106	0.146	Q8IDG8.pdb.gz	Q8IDG8_PLAF7 Membrane associated histidine-rich protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1353200 PE=4 SV=1
9	AFDB:O23129	0.275	0.050	2.775	1131	0.111	0.019	O23129.pdb.gz	O23129_ARATH T-complex protein 11 OS=Arabidopsis thaliana OX=3702 GN=At1g22930 PE=1 SV=1
10	AFDB:P18847	0.325	0.338	2.775	181	0.106	0.110	P18847.pdb.gz	ATF3_HUMAN Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=2
11	PDB:3ghgI	0.257	0.135	3.552	394	0.095	0.046	3ghgI.pdb.gz	Crystal structure of human fibrinogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QUI1	1.14e-106	305	189	0.963	0.963	LRA25_MOUSE Leucine repeat adapter protein 25 OS=Mus musculus OX=10090 GN=Fam89b PE=1 SV=1
2	Q566R4	5.67e-106	303	189	0.963	0.963	LRA25_RAT Leucine repeat adapter protein 25 OS=Rattus norvegicus OX=10116 GN=Fam89b PE=1 SV=1
3	Q8IV03	0.057	35.8	228	0.090	0.075	LUR1L_HUMAN Leucine rich adaptor protein 1-like OS=Homo sapiens OX=9606 GN=LURAP1L PE=1 SV=3
4	A7MC09	0.074	35.4	286	0.116	0.077	A7MC09_DANRE Leucine rich adaptor protein 1 OS=Danio rerio OX=7955 GN=lurap1 PE=2 SV=1
5	P33339	2.0	31.6	1025	0.090	0.017	TFC4_YEAST Transcription factor tau 131 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFC4 PE=1 SV=1
6	A0A0B4K843	3.5	30.8	1397	0.116	0.016	A0A0B4K843_DROME Bruchpilot, isoform I OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
7	Q86YV0	3.5	30.8	1011	0.116	0.022	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
8	Q8MRS3	3.6	30.8	1057	0.116	0.021	Q8MRS3_DROME AT09405p OS=Drosophila melanogaster OX=7227 GN=brp PE=2 SV=1
9	Q8MQY1	5.2	30.0	696	0.079	0.022	Q8MQY1_DROME SD01848p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CPT2 PE=2 SV=1
10	A1Z7V1	5.5	30.0	1740	0.116	0.013	A1Z7V1_DROME Bruchpilot, isoform D OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
11	A0A0B4KF38	5.9	30.0	1498	0.116	0.015	A0A0B4KF38_DROME Bruchpilot, isoform M OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
12	Q25B55	5.9	30.0	1740	0.116	0.013	Q25B55_DROME CAST OS=Drosophila melanogaster OX=7227 GN=brp PE=2 SV=1
13	P24178	6.1	28.9	118	0.079	0.127	YFFB_ECOLI Protein YffB OS=Escherichia coli (strain K12) OX=83333 GN=yffB PE=1 SV=1
14	A8DY79	6.7	30.0	1786	0.116	0.012	A8DY79_DROME Bruchpilot, isoform G OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=2
15	A0A0B4K6V0	6.9	30.0	1781	0.116	0.012	A0A0B4K6V0_DROME Bruchpilot, isoform L OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
16	A0A0B4K7V8	7.6	29.6	1707	0.116	0.013	A0A0B4K7V8_DROME Bruchpilot, isoform K OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
17	P87152	9.2	29.6	992	0.079	0.015	SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14854 LURAP	0.012	26.9	Leucine rich adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380880	0.769	PQ-loop repeat-containing protein 1
2	9606.ENSP00000312318	0.716	Sjoegren syndrome/scleroderma autoantigen 1
3	9606.ENSP00000359042	0.714	Pre-mRNA-splicing factor 38B
4	9606.ENSP00000309597	0.692	Mitogen-activated protein kinase kinase kinase 11
5	9606.ENSP00000279249	0.675	Cdc42 effector protein 2
6	9606.ENSP00000419249	0.673	RIIa domain-containing protein 1
7	9606.ENSP00000362444	0.663	Disks large-associated protein 3
8	9606.ENSP00000436901	0.658	Zinc finger protein ubi-d4
9	9606.ENSP00000308354	0.646	Tigger transposable element-derived protein 3
10	9606.ENSP00000477352	0.640	Short coiled-coil protein
11	9606.ENSP00000312671	0.639	EH domain-binding protein 1-like protein 1
12	9606.ENSP00000319726	0.638	Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface . Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6
13	9606.ENSP00000216442	0.637	V-type proton ATPase subunit D
14	9606.ENSP00000344820	0.629	Potassium channel subfamily K member 7
15	9606.ENSP00000358363	0.619	Myomegalin
16	9606.ENSP00000381782	0.569	Solute carrier family 25 member 45
17	9606.ENSP00000359768	0.518	E3 SUMO-protein ligase KIAA1586
18	9606.ENSP00000301873	0.516	Latent-transforming growth factor beta-binding protein 3
19	9606.ENSP00000186436	0.515	Transmembrane protein 131
20	9606.ENSP00000258243	0.506	URB2 ribosome biogenesis 2 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048523	0.987	negative regulation of cellular process
GO:0090092	0.981	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903844	0.980	regulation of cellular response to transforming growth factor beta stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0017015	0.957	regulation of transforming growth factor beta receptor signaling pathway
GO:1902531	0.951	regulation of intracellular signal transduction
GO:0090101	0.940	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007163	0.922	establishment or maintenance of cell polarity
GO:0030512	0.921	negative regulation of transforming growth factor beta receptor signaling pathway
GO:2000145	0.908	regulation of cell motility
GO:0030334	0.899	regulation of cell migration
GO:0040017	0.793	positive regulation of locomotion
GO:2000147	0.759	positive regulation of cell motility
GO:1902532	0.612	negative regulation of intracellular signal transduction
GO:0030335	0.556	positive regulation of cell migration
GO:0030010	0.432	establishment of cell polarity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0030027	0.985	lamellipodium
GO:0043229	0.931	intracellular organelle
GO:0043227	0.864	membrane-bounded organelle
GO:0005829	0.774	cytosol
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0016020	0.664	membrane
GO:0043232	0.370	intracellular non-membrane-bounded organelle
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]