StarFunc result for job id Q8N5I2

User Input

>input (433 residues)
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
SCGGVEPSLTPES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5I2	1.000	1.000	3.038E-73	433	1.000	1.000	Q8N5I2.pdb.gz	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
2	AFDB:Q8TBH0	0.607	0.644	6.502E-25	407	0.226	0.241	Q8TBH0.pdb.gz	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
3	AFDB:Q7TPQ9	0.604	0.631	3.107E-24	414	0.187	0.196	Q7TPQ9.pdb.gz	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
4	AFDB:A0A0B4J1F4	0.598	0.623	7.645E-24	415	0.240	0.251	A0A0B4J1F4.pdb.gz	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
5	AFDB:Q9VGU4	0.514	0.437	3.907E-22	520	0.233	0.194	Q9VGU4.pdb.gz	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2
6	AFDB:Q8SYU5	0.557	0.520	8.920E-21	469	0.201	0.186	Q8SYU5.pdb.gz	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
7	AFDB:O14972	0.414	0.564	3.246E-17	297	0.118	0.172	O14972.pdb.gz	VP26C_HUMAN Vacuolar protein sorting-associated protein 26C OS=Homo sapiens OX=9606 GN=VPS26C PE=1 SV=1
8	PDB:5f0jB	0.494	0.674	3.847E-15	306	0.095	0.134	5f0jB.pdb.gz
9	AFDB:P40335	0.481	0.544	1.468E-14	379	0.099	0.113	P40335.pdb.gz	PEP8_YEAST Carboxypeptidase Y-deficient protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP8 PE=1 SV=2
10	AFDB:Q9UU84	0.470	0.477	3.133E-14	426	0.109	0.110	Q9UU84.pdb.gz	MU170_SCHPO Meiotically up-regulated gene 170 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug170 PE=1 SV=1
11	PDB:2r51A	0.494	0.711	3.246E-14	288	0.102	0.153	2r51A.pdb.gz
12	AFDB:Q7T2D2	0.473	0.499	1.238E-13	408	0.145	0.154	Q7T2D2.pdb.gz	Q7T2D2_DANRE Arrb2b protein OS=Danio rerio OX=7955 GN=arrb2 PE=1 SV=1
13	PDB:2wtrB	0.433	0.500	3.011E-13	367	0.127	0.150	2wtrB.pdb.gz
14	PDB:5tv1A	0.480	0.599	1.912E-12	337	0.132	0.169	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
15	PDB:5w0pC	0.439	0.244	1.335E-11	850	0.113	0.058	5w0pC.pdb.gz
16	PDB:7jsmB	0.430	0.479	2.472E-11	383	0.113	0.128	7jsmB.pdb.gz
17	PDB:3gc3A	0.469	0.596	4.366E-11	329	0.125	0.164	3gc3A.pdb.gz
18	PDB:3gd1E	0.384	0.524	1.883E-8	300	0.118	0.170	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
19	PDB:1f13A	0.180	0.120	2.603E-6	722	0.072	0.043	1f13A.pdb.gz
20	PDB:5mhlA	0.152	0.107	2.603E-6	692	0.067	0.042	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5I2	0.0	872	433	1.000	1.000	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
2	Q8SYE1	1.11e-24	106	342	0.187	0.237	Q8SYE1_DROME RE65532p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
3	Q0E8K8	1.88e-24	105	342	0.187	0.237	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
4	Q8NCT1	5.96e-23	102	418	0.210	0.218	ARRD4_HUMAN Arrestin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ARRDC4 PE=1 SV=3
5	A0A0B4J1F4	1.28e-21	98.6	415	0.206	0.214	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
6	Q8TBH0	1.33e-21	98.2	407	0.201	0.214	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
7	Q7TPQ9	1.83e-21	98.2	414	0.192	0.200	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
8	Q96B67	2.97e-21	97.4	414	0.192	0.200	ARRD3_HUMAN Arrestin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARRDC3 PE=1 SV=1
9	Q8SYW4	1.98e-18	87.0	271	0.141	0.225	Q8SYW4_DROME RE30730p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
10	Q5M7W1	5.61e-17	84.3	394	0.159	0.175	TXNIP_RAT Thioredoxin-interacting protein OS=Rattus norvegicus OX=10116 GN=Txnip PE=2 SV=1
11	O45782	7.73e-17	84.3	426	0.182	0.185	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
12	Q9H3M7	1.32e-16	83.2	391	0.164	0.182	TXNIP_HUMAN Thioredoxin-interacting protein OS=Homo sapiens OX=9606 GN=TXNIP PE=1 SV=1
13	Q8BG60	8.41e-16	80.9	397	0.152	0.166	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
14	Q9XXI4	4.02e-15	79.0	419	0.185	0.191	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
15	Q20577	1.64e-13	73.6	346	0.134	0.168	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
16	P30647	1.80e-13	73.6	374	0.150	0.174	ARD15_CAEEL Arrestin domain-containing protein 15 OS=Caenorhabditis elegans OX=6239 GN=arrd-15 PE=3 SV=2
17	I2HAB8	3.74e-13	72.8	357	0.150	0.182	I2HAB8_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-15 PE=3 SV=1
18	I2HAB9	3.92e-13	72.8	370	0.150	0.176	I2HAB9_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-15 PE=3 SV=1
19	Q8SYU5	2.36e-11	67.8	469	0.189	0.175	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
20	Q9VGU4	3.77e-09	60.8	520	0.192	0.160	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02752 Arrestin_C	1.3e-20	85.7	Arrestin (or S-antigen), C-terminal domain
2	PF00339 Arrestin_N	3.6e-15	67.7	Arrestin (or S-antigen), N-terminal domain
3	PF03643 Vps26	0.71	20.4	Vacuolar protein sorting-associated protein 26
4	PF10103 Zincin_2	4.8e+02	11.4	Zincin-like metallopeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251968	0.994	Tumor susceptibility gene 101 protein
2	9606.ENSP00000352069	0.916	NEDD4-like E3 ubiquitin-protein ligase WWP2
3	9606.ENSP00000480499	0.856	E3 ubiquitin-protein ligase Itchy homolog
4	9606.ENSP00000427793	0.845	NEDD4-like E3 ubiquitin-protein ligase WWP1
5	9606.ENSP00000424827	0.810	E3 ubiquitin-protein ligase NEDD4
6	9606.ENSP00000383199	0.748	E3 ubiquitin-protein ligase NEDD4-like
7	9606.ENSP00000362480	0.745	Vacuolar protein sorting-associated protein 26A
8	9606.ENSP00000318629	0.732	Vacuolar protein sorting-associated protein 37A
9	9606.ENSP00000311399	0.705	Down syndrome critical region gene 3
10	9606.ENSP00000386444	0.699	S-arrestin
11	9606.ENSP00000281187	0.693	Vacuolar protein sorting-associated protein 26B
12	9606.ENSP00000305372	0.673	Beta-2 adrenergic receptor
13	9606.ENSP00000478927	0.569	Transcriptional coactivator YAP1
14	9606.ENSP00000409581	0.566	Beta-arrestin-1
15	9606.ENSP00000411825	0.563	Programmed cell death 6-interacting protein
16	9606.ENSP00000259873	0.531	Mitochondrial ribosomal protein S18B
17	9606.ENSP00000311538	0.514	Arrestin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0042802	0.999	identical protein binding
GO:1990763	0.936	arrestin family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0006508	0.995	proteolysis
GO:0070647	0.995	protein modification by small protein conjugation or removal
GO:0009966	0.991	regulation of signal transduction
GO:0016567	0.987	protein ubiquitination
GO:0006511	0.987	ubiquitin-dependent protein catabolic process
GO:0033036	0.980	macromolecule localization
GO:0051641	0.978	cellular localization
GO:0009968	0.977	negative regulation of signal transduction
GO:0008593	0.965	regulation of Notch signaling pathway
GO:0008104	0.952	protein localization
GO:0071705	0.945	nitrogen compound transport
GO:0045746	0.931	negative regulation of Notch signaling pathway
GO:0071840	0.927	cellular component organization or biogenesis
GO:0045184	0.927	establishment of protein localization
GO:0071702	0.917	organic substance transport
GO:0006858	0.873	extracellular transport
GO:0044085	0.780	cellular component biogenesis
GO:0015031	0.630	protein transport
GO:0019222	0.429	regulation of metabolic process
GO:0048518	0.317	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0070062	0.996	extracellular exosome
GO:0012505	0.946	endomembrane system
GO:0005829	0.931	cytosol
GO:0005768	0.449	endosome
GO:0031090	0.363	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]