StarFunc result for job id Q8N5I3

User Input

>input (272 residues)
MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSF
ILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQ
AFFRVFGSCSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQC
GSDSTTDNQTGVRYVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSSEDKTECY
SFERIKSPEVLITNETPKPETIIIPEQSQIKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5I3	1.000	1.000	4.407E-55	272	1.000	1.000	Q8N5I3.pdb.gz	KCNRG_HUMAN Potassium channel regulatory protein OS=Homo sapiens OX=9606 GN=KCNRG PE=1 SV=1
2	AFDB:Q4G0X4	0.512	0.531	3.442E-16	260	0.232	0.242	Q4G0X4.pdb.gz	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
3	AFDB:Q8NC69	0.343	0.392	9.762E-15	237	0.217	0.249	Q8NC69.pdb.gz	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
4	AFDB:Q5XJ34	0.376	0.396	3.348E-14	257	0.202	0.214	Q5XJ34.pdb.gz	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
5	AFDB:Q8K0E1	0.369	0.357	5.677E-14	283	0.195	0.187	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
6	AFDB:Q68DU8	0.380	0.252	1.731E-13	428	0.254	0.161	Q68DU8.pdb.gz	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
7	AFDB:A0A2U3U043	0.359	0.123	7.080E-13	865	0.184	0.058	A0A2U3U043.pdb.gz	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
8	AFDB:Q9VDH3	0.379	0.444	1.432E-12	228	0.188	0.224	Q9VDH3.pdb.gz	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
9	AFDB:Q50H33	0.365	0.218	2.290E-12	476	0.268	0.153	Q50H33.pdb.gz	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
10	PDB:6sgaFS	0.289	0.284	3.811E-12	277	0.184	0.181	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
11	AFDB:Q804Q4	0.384	0.364	8.327E-12	288	0.261	0.247	Q804Q4.pdb.gz	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
12	PDB:7phhA	0.290	0.203	1.521E-5	396	0.092	0.063	7phhA.pdb.gz
13	PDB:7sizB	0.290	0.239	1.613E-5	334	0.099	0.081	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
14	PDB:7w6sB	0.296	0.184	2.900E-5	448	0.096	0.058	7w6sB.pdb.gz
15	PDB:3lutB	0.317	0.225	3.668E-5	390	0.096	0.067	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	PDB:2a79B	0.316	0.331	4.125E-5	259	0.096	0.100	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
17	PDB:7f3fA	0.275	0.171	2.262E-4	460	0.118	0.070	7f3fA.pdb.gz
18	PDB:7pquA	0.281	0.236	4.851E-4	328	0.099	0.082	7pquA.pdb.gz
19	PDB:7sszA	0.300	0.229	6.134E-4	362	0.088	0.066	7sszA.pdb.gz
20	PDB:1i8dA	0.155	0.196	1.957E-2	206	0.055	0.073	1i8dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5I3	0.0	556	272	1.000	1.000	KCNRG_HUMAN Potassium channel regulatory protein OS=Homo sapiens OX=9606 GN=KCNRG PE=1 SV=1
2	Q4G0X4	1.46e-18	84.7	260	0.151	0.158	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
3	Q68DU8	8.12e-18	84.7	428	0.169	0.107	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
4	Q5DTY9	2.09e-17	83.6	427	0.165	0.105	KCD16_MOUSE BTB/POZ domain-containing protein KCTD16 OS=Mus musculus OX=10090 GN=Kctd16 PE=1 SV=2
5	Q8C7J6	9.19e-17	80.5	292	0.147	0.137	Q8C7J6_MOUSE Potassium channel tetramerisation domain containing 12b OS=Mus musculus OX=10090 GN=Kctd12b PE=1 SV=1
6	Q804Q4	2.97e-16	79.0	288	0.154	0.146	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
7	Q719H9	5.62e-16	77.4	257	0.125	0.132	KCTD1_HUMAN BTB/POZ domain-containing protein KCTD1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
8	Q8K0E1	9.46e-16	77.4	283	0.132	0.127	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
9	A0A2U3U043	9.61e-16	79.0	865	0.129	0.040	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
10	Q96SI1	1.09e-15	77.0	283	0.129	0.124	KCD15_HUMAN BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens OX=9606 GN=KCTD15 PE=1 SV=1
11	Q6DC02	1.77e-15	76.3	257	0.129	0.136	KCD15_DANRE BTB/POZ domain-containing protein kctd15 OS=Danio rerio OX=7955 GN=kctd15 PE=1 SV=1
12	Q50H33	1.87e-15	77.8	476	0.162	0.092	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
13	Q96CX2	2.74e-15	76.6	325	0.165	0.138	KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1
14	Q6ZWB6	3.23e-15	77.0	473	0.158	0.091	KCTD8_HUMAN BTB/POZ domain-containing protein KCTD8 OS=Homo sapiens OX=9606 GN=KCTD8 PE=1 SV=1
15	Q8NC69	4.13e-15	74.7	237	0.199	0.228	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
16	Q5XJ34	5.46e-15	74.7	257	0.125	0.132	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
17	Q6WVG3	7.96e-15	75.1	327	0.162	0.135	KCD12_MOUSE BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1
18	Q9VDH3	1.31e-13	70.5	228	0.151	0.180	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
19	Q561T3	2.90e-13	70.1	271	0.143	0.144	Q561T3_DANRE Potassium channel tetramerisation domain-containing 12.2 OS=Danio rerio OX=7955 GN=ron PE=1 SV=2
20	Q9BQ13	3.33e-12	67.0	255	0.143	0.153	KCD14_HUMAN BTB/POZ domain-containing protein KCTD14 OS=Homo sapiens OX=9606 GN=KCTD14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	9.2e-14	62.9	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348299	0.909	E3 ubiquitin-protein ligase TRIM13
2	9606.ENSP00000367422	0.905	Leukemia-associated protein 1
3	9606.ENSP00000354774	0.805	SPRY domain containing 7
4	9606.ENSP00000340132	0.653	Zinc finger protein 383
5	9606.ENSP00000253354	0.633	BPI fold-containing family B member 1
6	9606.ENSP00000305702	0.633	BTB/POZ domain-containing protein KCTD19
7	9606.ENSP00000391498	0.629	Potassium channel subfamily K member 16
8	9606.ENSP00000362328	0.622	Potassium channel subfamily K member 17
9	9606.ENSP00000355658	0.606	E3 ubiquitin-protein ligase TRIM17
10	9606.ENSP00000431186	0.603	BTB/POZ domain-containing protein 10
11	9606.ENSP00000238855	0.586	Aftiphilin
12	9606.ENSP00000295756	0.577	T-cell receptor-associated transmembrane adapter 1
13	9606.ENSP00000308893	0.577	Sushi, nidogen and EGF-like domain-containing protein 1
14	9606.ENSP00000359050	0.577	UPF0668 protein C10orf76
15	9606.ENSP00000296125	0.556	Protein-glutamine gamma-glutamyltransferase 4
16	9606.ENSP00000264042	0.552	FERM, ARHGEF and pleckstrin domain-containing protein 2
17	9606.ENSP00000301738	0.551	BTB/POZ domain-containing protein KCTD5
18	9606.ENSP00000328511	0.545	Potassium voltage-gated channel subfamily A member 4
19	9606.ENSP00000366404	0.527	Zinc finger protein RFP
20	9606.ENSP00000334373	0.519	Importin subunit alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.989	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0043266	0.918	regulation of potassium ion transport
GO:2001257	0.911	regulation of cation channel activity
GO:0043271	0.908	negative regulation of monoatomic ion transport
GO:0032413	0.891	negative regulation of ion transmembrane transporter activity
GO:1901379	0.815	regulation of potassium ion transmembrane transport
GO:0043267	0.756	negative regulation of potassium ion transport
GO:1904063	0.756	negative regulation of cation transmembrane transport
GO:1901016	0.743	regulation of potassium ion transmembrane transporter activity
GO:2001258	0.743	negative regulation of cation channel activity
GO:0009987	0.679	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005783	0.787	endoplasmic reticulum
GO:0005634	0.709	nucleus
GO:0070013	0.383	intracellular organelle lumen
GO:0031981	0.372	nuclear lumen
GO:0016020	0.327	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]