StarFunc result for job id Q8N5R6

User Input

>input (958 residues)
MAFRGPEPWVSASLLRQRLKAEEKTLDLEFEVLSVGFNEAGRYALRLSAENPLQVGSGAG
VQLQVNDGDPFPACSAITDVIEQQEPGQSLTLTRSKFIFTLPKGFCKNDGQHDAQLHVEA
LRLDEPLGRAAQRVGEAIFPIYPRPDQPRMNPKAQDHEDLYRYCGNLALLRASTDPTARH
CGSLAYSVAFHVHRGPQPPVSDSPPRAGQPELMSPEEPLIASQSTEPEIGHLSPSKKETI
MVTLHGATNLPACKDGSEPWPYVVVKSTSEEKNNQSSKAVTSVTSEPTRAPIWGDTVNVE
IQAEDAGQEDVILKVVDNRKKQELLSYKIPIKYLRVFHPYHFELVKPTESGKADEATAKT
QLYATVVRKSSFIPRYIGCNHMALEIFLRGVNEPLANNPNPIVVIARVVPNYKEFKVSQA
NRDLASVGLPITPLSFPIPSMMNFDVPRVSQNGCPQLSKPGGPPEQPLWNQSFLFQGRDG
ATSFSEDTALVLEYYSSTSMKGSQPWTLNQPLGISVLPLKSRLYQKMLTGKGLDGLHVER
LPIMDTSLKTINDEAPTVALSFQLLSSERPENFLTPNNSKALPTLDPKILDKKLRTIQES
WSKDTVSSTMDLSTSTPREAEEEPLVPEMSHDTEMNNYRRAMQKMAEDILSLRRQASILE
GENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKN
DREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSK
PPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQAP
IILQQQALPDLLSGTSDKFNLLAKLEHAQSRILSLESQLEDSARRWGREKQDLATRLQEQ
EKGFRHPSNSIIIEQPSALTHSMDLKQPSELEPLLPSSDSKLNKPLSPQKETANSQQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5R6	1.000	1.000	0.000	958	1.000	1.000	Q8N5R6.pdb.gz	CCD33_HUMAN Coiled-coil domain-containing protein 33 OS=Homo sapiens OX=9606 GN=CCDC33 PE=1 SV=3
2	AFDB:Q3ULW6	0.220	0.215	1.513E-94	985	0.678	0.660	Q3ULW6.pdb.gz	CCD33_MOUSE Coiled-coil domain-containing protein 33 OS=Mus musculus OX=10090 GN=Ccdc33 PE=2 SV=2
3	AFDB:E9QHV7	0.117	0.085	8.915E-12	1342	0.088	0.063	E9QHV7.pdb.gz
4	PDB:5iz5B	0.116	0.146	8.539E-9	746	0.053	0.068	5iz5B.pdb.gz
5	AFDB:F1PKQ6	0.133	0.110	1.217E-8	1209	0.080	0.064	F1PKQ6.pdb.gz	F1PKQ6_CANLF RPGR-interacting protein 1 OS=Canis lupus familiaris OX=9615 GN=RPGRIP1 PE=2 SV=2
6	PDB:5iz5A	0.114	0.143	2.869E-8	757	0.051	0.065	5iz5A.pdb.gz
7	PDB:6kxkD	0.115	0.182	1.254E-7	553	0.054	0.094	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
8	PDB:5ixcA	0.114	0.158	4.443E-7	684	0.044	0.061	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
9	PDB:5izrC	0.114	0.163	3.468E-6	659	0.047	0.068	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	AFDB:Q96KN7	0.133	0.103	8.823E-6	1286	0.069	0.051	Q96KN7.pdb.gz	RPGR1_HUMAN X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2
11	AFDB:Q580U6	0.110	0.112	1.660E-5	944	0.041	0.041	Q580U6.pdb.gz	Q580U6_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.440 PE=4 SV=1
12	PDB:1cjyA	0.114	0.169	1.184E-4	633	0.019	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5a50A	0.103	0.466	5.177E-4	165	0.022	0.127	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:4rj9A	0.100	0.485	6.737E-4	161	0.033	0.199	4rj9A.pdb.gz
15	PDB:5a52A	0.094	0.463	9.743E-4	154	0.022	0.136	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:4yknA	0.110	0.090	1.203E-3	1205	0.018	0.014	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
17	AFDB:Q580S2	0.123	0.056	2.612E-3	2463	0.063	0.024	Q580S2.pdb.gz	Q580S2_TRYB2 Tb-292 membrane associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.760 PE=3 SV=1
18	AFDB:Q57XV2	0.070	0.033	1.410E-2	2327	0.066	0.027	Q57XV2.pdb.gz	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
19	AFDB:A7MCY6	0.094	0.141	3.454E-2	615	0.082	0.128	A7MCY6.pdb.gz	TBKB1_HUMAN TANK-binding kinase 1-binding protein 1 OS=Homo sapiens OX=9606 GN=TBKBP1 PE=1 SV=1
20	AFDB:Q08CF3	0.080	0.135	3.158E-1	511	0.065	0.121	Q08CF3.pdb.gz	CCD61_DANRE Centrosomal protein CCDC61 OS=Danio rerio OX=7955 GN=ccdc61 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ULW6	0.0	1113	985	0.613	0.596	CCD33_MOUSE Coiled-coil domain-containing protein 33 OS=Mus musculus OX=10090 GN=Ccdc33 PE=2 SV=2
2	Q8N5R6	0.0	1965	958	1.000	1.000	CCD33_HUMAN Coiled-coil domain-containing protein 33 OS=Homo sapiens OX=9606 GN=CCDC33 PE=1 SV=3
3	M9PBZ4	0.031	40.8	18014	0.067	0.004	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
4	M9PB32	0.033	40.8	19560	0.067	0.003	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PC45	0.040	40.4	22300	0.067	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PBZ0	0.043	40.4	22830	0.067	0.003	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PCJ8	0.043	40.4	14825	0.067	0.004	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PEH5	0.043	40.4	20710	0.067	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PEI1	0.043	40.4	21657	0.067	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9NCR4	0.044	40.4	15105	0.067	0.004	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9NER8	0.044	40.4	15638	0.067	0.004	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PB30	0.044	40.4	22949	0.067	0.003	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
13	M9PC41	0.046	40.4	22743	0.067	0.003	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PB31	0.077	39.7	20404	0.067	0.003	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	Q155Q3	0.64	36.2	683	0.038	0.053	DIXC1_HUMAN Dixin OS=Homo sapiens OX=9606 GN=DIXDC1 PE=1 SV=2
16	E7EUP3	0.66	36.2	425	0.017	0.038	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
17	Q96AQ6	0.86	35.8	731	0.044	0.057	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
18	Q5SVQ0	0.87	35.8	613	0.017	0.026	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1
19	Q8IDX6	0.89	36.2	3130	0.067	0.020	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
20	O95251	0.94	35.8	611	0.017	0.026	KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.00037	32.1	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006371

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000008212	0.570	DDB1 and CUL4 associated factor 12
2	9593.ENSGGOP00000011766	0.546	LEM domain containing 1
3	9593.ENSGGOP00000010337	0.540	Transferrin
4	9593.ENSGGOP00000021415	0.535	Sperm associated antigen 9
5	9593.ENSGGOP00000019833	0.525	Coiled-coil domain containing 110

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0050794	0.955	regulation of cellular process
GO:0009987	0.880	cellular process
GO:0010646	0.740	regulation of cell communication
GO:0023051	0.589	regulation of signaling
GO:0048583	0.495	regulation of response to stimulus
GO:0032502	0.305	developmental process
GO:0048856	0.300	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042579	0.995	microbody
GO:0005777	0.979	peroxisome
GO:0043232	0.401	intracellular non-membrane-bounded organelle
GO:0005815	0.374	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]