StarFunc result for job id Q8N5S1

User Input

>input (370 residues)
MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDN
NLEHLPSQQVLDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYM
QVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGI
QGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRA
LYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMAS
YPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVV
YEAMKKTLGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BVN7	0.770	0.908	1.244E-31	312	0.708	0.840	Q8BVN7.pdb.gz	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
2	AFDB:Q9BV35	0.726	0.579	6.056E-26	468	0.511	0.404	Q9BV35.pdb.gz	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
3	AFDB:A2ASZ8	0.721	0.572	2.088E-24	469	0.441	0.348	A2ASZ8.pdb.gz	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
4	AFDB:A2CEQ0	0.744	0.591	1.364E-23	469	0.451	0.356	A2CEQ0.pdb.gz	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
5	AFDB:Q6NUK1	0.717	0.562	4.905E-23	477	0.441	0.342	Q6NUK1.pdb.gz	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
6	AFDB:B1AUS6	0.702	0.556	6.341E-22	473	0.373	0.292	B1AUS6.pdb.gz	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
7	AFDB:Q9LY28	0.702	0.550	4.331E-19	479	0.330	0.255	Q9LY28.pdb.gz	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
8	AFDB:Q9FLS8	0.689	0.539	8.943E-19	478	0.324	0.251	Q9FLS8.pdb.gz	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
9	AFDB:Q9SUV1	0.682	0.646	3.356E-18	392	0.268	0.253	Q9SUV1.pdb.gz	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
10	AFDB:P29518	0.720	0.617	6.363E-18	436	0.300	0.255	P29518.pdb.gz	BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays OX=4577 GN=BT1 PE=1 SV=1
11	PDB:2c3eA	0.621	0.770	9.410E-12	293	0.219	0.276	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.598	0.752	1.381E-11	290	0.186	0.238	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.421	0.501	2.628E-7	292	0.211	0.267	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.422	0.494	2.525E-4	297	0.176	0.219	2lckA.pdb.gz
15	PDB:7jsjA	0.126	0.109	2.642E-1	468	0.105	0.083	7jsjA.pdb.gz	Structure and inhibition mechanism of the human citrate transporter NaCT.
16	PDB:6jbjA	0.178	0.133	3.133E-1	565	0.108	0.071	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
17	PDB:7td3R	0.138	0.155	3.716E-1	292	0.111	0.140	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
18	PDB:4f4cA	0.130	0.051	4.800E-1	1250	0.130	0.038	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
19	PDB:3b9yA	0.121	0.117	5.455E-1	388	0.105	0.101	3b9yA.pdb.gz
20	PDB:2nq2A	0.122	0.142	5.693E-1	308	0.116	0.140	2nq2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BVN7	0.0	536	312	0.708	0.840	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
2	Q9BV35	6.27e-128	377	468	0.541	0.427	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
3	Q6GQS1	1.08e-123	366	467	0.524	0.415	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
4	A2ASZ8	1.47e-110	333	469	0.459	0.362	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
5	A2CEQ0	5.71e-110	331	469	0.459	0.362	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
6	Q8BMD8	1.68e-109	330	475	0.459	0.358	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
7	Q6NUK1	2.22e-109	330	477	0.449	0.348	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
8	B1AUS6	5.13e-85	267	473	0.378	0.296	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
9	Q9D5G5	5.42e-85	267	473	0.378	0.296	Q9D5G5_MOUSE EF-hand domain-containing protein OS=Mus musculus OX=10090 GN=Slc25a54 PE=2 SV=1
10	Q9FI43	3.30e-61	206	487	0.332	0.253	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
11	Q9FLS8	4.98e-60	202	478	0.346	0.268	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
12	Q9LY28	1.94e-56	193	479	0.338	0.261	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
13	O94502	2.11e-48	171	426	0.346	0.300	YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12D12.05c PE=3 SV=2
14	Q9SUV1	7.23e-47	166	392	0.281	0.265	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
15	F4JHS4	1.40e-45	162	366	0.281	0.284	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
16	Q0P483	1.38e-42	152	321	0.262	0.302	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
17	Q6I583	1.46e-42	153	355	0.273	0.285	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
18	P29518	2.33e-41	152	436	0.265	0.225	BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays OX=4577 GN=BT1 PE=1 SV=1
19	A0A0B4LIE8	2.62e-39	145	364	0.284	0.288	A0A0B4LIE8_DROME Dephosphocoenzyme A carrier, isoform D OS=Drosophila melanogaster OX=7227 GN=DPCoAC PE=3 SV=1
20	B4F8I5	8.09e-39	143	335	0.235	0.260	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	1.1e-60	212.9	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369407	0.750	Solute carrier family 25 member 35
2	9606.ENSP00000407653	0.610	Proline-rich protein 22
3	9606.ENSP00000371037	0.573	Cation channel sperm-associated protein subunit delta
4	9606.ENSP00000368468	0.561	Mitochondrial calcium uniporter regulator 1
5	9606.ENSP00000378145	0.524	Calcium uniporter regulatory subunit MCUb, mitochondrial
6	9606.ENSP00000450857	0.504	Stonin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:1901702	0.997	salt transmembrane transporter activity
GO:1901505	0.995	carbohydrate derivative transmembrane transporter activity
GO:0005347	0.993	ATP transmembrane transporter activity
GO:0005488	0.920	binding
GO:0015217	0.832	ADP transmembrane transporter activity
GO:0005515	0.779	protein binding
GO:0022804	0.351	active transmembrane transporter activity
GO:0015291	0.306	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051179	0.987	localization
GO:0006810	0.970	transport
GO:0055085	0.936	transmembrane transport
GO:0071702	0.908	organic substance transport
GO:1990542	0.902	mitochondrial transmembrane transport
GO:0015748	0.847	organophosphate ester transport
GO:0015865	0.828	purine nucleotide transport
GO:1901264	0.511	carbohydrate derivative transport
GO:0065007	0.494	biological regulation
GO:0051503	0.460	adenine nucleotide transport
GO:0050789	0.457	regulation of biological process
GO:0050794	0.426	regulation of cellular process
GO:0015868	0.370	purine ribonucleotide transport
GO:0015711	0.361	organic anion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.918	membrane
GO:0031090	0.869	organelle membrane
GO:0005740	0.636	mitochondrial envelope
GO:0031966	0.633	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]