StarFunc result for job id Q8N5S9

User Input

>input (505 residues)
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSR
LLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILA
LHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LVKEGFGEGGKSPELPGVQEDEAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97756	0.799	0.799	2.352E-87	505	0.937	0.937	P97756.pdb.gz	KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1
2	AFDB:F1RGR1	0.716	0.680	5.750E-82	532	0.949	0.900	F1RGR1.pdb.gz	F1RGR1_PIG Calcium/calmodulin dependent protein kinase kinase 1 OS=Sus scrofa OX=9823 GN=CAMKK1 PE=4 SV=4
3	AFDB:A0A024RBQ0	0.723	0.625	4.425E-64	588	0.594	0.510	A0A024RBQ0.pdb.gz
4	AFDB:A0A024RBP8	0.608	0.564	2.134E-56	545	0.533	0.494	A0A024RBP8.pdb.gz
5	AFDB:Q3Y416	0.647	0.605	1.172E-51	541	0.432	0.403	Q3Y416.pdb.gz	KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans OX=6239 GN=ckk-1 PE=1 SV=2
6	AFDB:Q54WW7	0.606	0.445	3.669E-38	695	0.307	0.223	Q54WW7.pdb.gz	Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279405 PE=3 SV=1
7	AFDB:C8V9K6	0.614	0.403	1.449E-36	789	0.327	0.209	C8V9K6.pdb.gz	C8V9K6_EMENI Calcium/calmodulin-dependent protein kinase CMKC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08827 PE=4 SV=1
8	AFDB:Q5HZ38	0.529	0.654	2.659E-31	407	0.246	0.305	Q5HZ38.pdb.gz	GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana OX=3702 GN=GRIK2 PE=1 SV=1
9	AFDB:Q93V58	0.523	0.664	1.407E-30	396	0.232	0.295	Q93V58.pdb.gz	GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana OX=3702 GN=GRIK1 PE=1 SV=1
10	AFDB:Q5A650	0.511	0.194	1.985E-30	1408	0.323	0.116	Q5A650.pdb.gz	Q5A650_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAK1 PE=4 SV=1
11	PDB:7myjC	0.489	0.528	1.963E-23	465	0.174	0.189	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:5u6yA	0.478	0.524	4.143E-23	459	0.204	0.224	5u6yA.pdb.gz
13	PDB:4zhxA	0.496	0.607	1.466E-22	409	0.174	0.215	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:6b1uA	0.506	0.576	6.527E-22	442	0.178	0.204	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:5ufuA	0.494	0.668	2.059E-21	369	0.164	0.225	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:6byrA	0.463	0.573	2.309E-21	405	0.180	0.225	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
17	PDB:4rewA	0.490	0.597	2.906E-21	411	0.166	0.204	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:4rerA	0.505	0.554	6.132E-21	459	0.176	0.194	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4d28C	0.468	0.809	1.028E-20	279	0.180	0.326	4d28C.pdb.gz
20	PDB:5x3fB	0.462	0.658	1.028E-20	349	0.178	0.258	5x3fB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RGR1	0.0	926	532	0.949	0.900	F1RGR1_PIG Calcium/calmodulin dependent protein kinase kinase 1 OS=Sus scrofa OX=9823 GN=CAMKK1 PE=4 SV=4
2	O88831	0.0	538	587	0.560	0.482	KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Camkk2 PE=1 SV=1
3	P97756	0.0	910	505	0.937	0.937	KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1
4	Q8C078	0.0	525	588	0.556	0.478	KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Camkk2 PE=1 SV=2
5	Q8N5S9	0.0	1031	505	1.000	1.000	KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2
6	Q8VBY2	0.0	927	505	0.935	0.935	KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Camkk1 PE=1 SV=1
7	Q96RR4	0.0	546	588	0.568	0.488	KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2 PE=1 SV=2
8	Q3Y416	9.76e-145	428	541	0.414	0.386	KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans OX=6239 GN=ckk-1 PE=1 SV=2
9	C8V9K6	4.49e-79	265	789	0.295	0.189	C8V9K6_EMENI Calcium/calmodulin-dependent protein kinase CMKC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08827 PE=4 SV=1
10	Q54WW7	2.63e-71	242	695	0.267	0.194	Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279405 PE=3 SV=1
11	P50526	3.04e-67	230	652	0.269	0.209	SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssp1 PE=1 SV=1
12	Q5HZ38	1.54e-58	201	407	0.220	0.273	GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana OX=3702 GN=GRIK2 PE=1 SV=1
13	Q93V58	2.43e-58	200	396	0.244	0.311	GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana OX=3702 GN=GRIK1 PE=1 SV=1
14	P43637	1.67e-49	180	560	0.238	0.214	TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOS3 PE=1 SV=1
15	Q5A650	1.02e-48	182	1408	0.265	0.095	Q5A650_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAK1 PE=4 SV=1
16	Q57YE4	1.62e-47	168	296	0.198	0.338	Q57YE4_TRYB2 Serine/threonine kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.490 PE=3 SV=1
17	P38990	3.81e-47	178	1142	0.291	0.129	SAK1_YEAST SNF1-activating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAK1 PE=1 SV=1
18	Q84VQ3	1.77e-44	164	439	0.220	0.253	CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CIPK26 PE=1 SV=2
19	Q9LDI3	4.70e-43	160	446	0.188	0.213	CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana OX=3702 GN=CIPK24 PE=1 SV=1
20	Q38997	1.82e-42	160	512	0.192	0.189	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.2e+02	13.2	ABC1 atypical kinase-like domain
2	PF01636 APH	8.2e+02	11.2	Phosphotransferase enzyme family
3	PF14531 Kinase-like	0.0014	29.6	Kinase-like
4	PF00069 Pkinase	6.8e-59	211.0	Protein kinase domain
5	PF17667 Pkinase_fungal	0.0057	27.1	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	4.6e-28	109.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003810269.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008950349.1	0.953	Belongs to the protein kinase superfamily.
2	9597.XP_008956012.1	0.925	Calcium/calmodulin dependent protein kinase kinase 2
3	9597.XP_003817536.1	0.904	Belongs to the calmodulin family.
4	9597.XP_003811018.1	0.820	5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
5	9597.XP_008976305.1	0.801	5'-AMP-activated protein kinase catalytic subunit alpha-2
6	9597.XP_008949399.1	0.798	5'-AMP-activated protein kinase subunit gamma-1 isoform X1
7	9597.XP_008970237.1	0.783	Serine/threonine-protein kinase BRSK2 isoform X1
8	9597.XP_008953218.1	0.777	Uncharacterized protein LOC100989509
9	9597.XP_008966217.1	0.777	5'-AMP-activated protein kinase subunit gamma-2 isoform X1
10	9597.XP_008974499.1	0.771	Calmodulin
11	9597.XP_008956435.1	0.769	Calmodulin isoform X1
12	9597.XP_008970221.1	0.748	5'-AMP-activated protein kinase subunit gamma-3
13	9597.XP_008965132.1	0.742	Calcium/calmodulin-dependent protein kinase type 1 isoform X1
14	9597.XP_003807343.1	0.737	Calmodulin like 6
15	9597.XP_003827833.1	0.737	Calmodulin like 5
16	9597.XP_003827834.1	0.737	Belongs to the calmodulin family.
17	9597.XP_003828060.1	0.737	Calmodulin-like protein 4 isoform X1
18	9597.XP_003809245.1	0.692	Protein kinase AMP-activated non-catalytic subunit beta 2
19	9597.XP_003832451.1	0.692	5'-AMP-activated protein kinase subunit beta-1
20	9597.XP_008951613.1	0.692	Calcium/calmodulin-dependent protein kinase type 1D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0005516	0.998	calmodulin binding
GO:0004683	0.902	calmodulin-dependent protein kinase activity
GO:0043167	0.394	ion binding
GO:0043169	0.324	cation binding
GO:1901363	0.313	heterocyclic compound binding
GO:0097159	0.313	organic cyclic compound binding
GO:0046872	0.305	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0006793	0.996	phosphorus metabolic process
GO:0065009	0.995	regulation of molecular function
GO:0006468	0.991	protein phosphorylation
GO:0050790	0.987	regulation of catalytic activity
GO:0042325	0.986	regulation of phosphorylation
GO:0051247	0.985	positive regulation of protein metabolic process
GO:0001932	0.982	regulation of protein phosphorylation
GO:0042327	0.976	positive regulation of phosphorylation
GO:0051347	0.969	positive regulation of transferase activity
GO:0043549	0.965	regulation of kinase activity
GO:0045859	0.964	regulation of protein kinase activity
GO:0045860	0.949	positive regulation of protein kinase activity
GO:0032147	0.861	activation of protein kinase activity
GO:0050896	0.559	response to stimulus
GO:0051716	0.378	cellular response to stimulus
GO:0007154	0.375	cell communication
GO:0007165	0.372	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.977	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.17	0.902	calcium/calmodulin-dependent protein kinase.

[back to server]