StarFunc result for job id Q8N5W9

User Input

>input (214 residues)
MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEP
DAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFID
DVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTT
TLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5W9	0.999	0.999	1.166E-35	214	1.000	1.000	Q8N5W9.pdb.gz	RFLB_HUMAN Refilin-B OS=Homo sapiens OX=9606 GN=RFLNB PE=1 SV=1
2	AFDB:Q5SVD0	0.299	0.296	7.677E-25	216	0.836	0.829	Q5SVD0.pdb.gz	RFLB_MOUSE Refilin-B OS=Mus musculus OX=10090 GN=Rflnb PE=1 SV=1
3	AFDB:Q6ZTI6	0.205	0.203	6.710E-9	216	0.393	0.389	Q6ZTI6.pdb.gz	RFLA_HUMAN Refilin-A OS=Homo sapiens OX=9606 GN=RFLNA PE=1 SV=3
4	PDB:3b07A	0.062	0.051	5.884E-1	284	0.089	0.067	3b07A.pdb.gz
5	AFDB:Q12215	0.135	0.064	6.893E-1	556	0.084	0.032	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
6	PDB:5apnP	0.116	0.132	1.102	183	0.061	0.071	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
7	PDB:4v6wCP	0.096	0.105	1.249	185	0.061	0.070	4v6wCP.pdb.gz	Structures of the human and Drosophila 80S ribosome.
8	PDB:7bk0B	0.090	0.080	1.821	250	0.061	0.052	7bk0B.pdb.gz
9	PDB:1dw9A	0.095	0.120	1.938	156	0.023	0.032	1dw9A.pdb.gz
10	AFDB:P53832	0.134	0.063	2.574	503	0.075	0.032	P53832.pdb.gz	WSC2_YEAST Cell wall integrity and stress response component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC2 PE=1 SV=1
11	PDB:6qw663	0.116	0.246	2.653	85	0.047	0.118	6qw663.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:3jd5L	0.089	0.141	2.825	109	0.061	0.119	3jd5L.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
13	PDB:7abzR	0.138	0.270	2.825	103	0.014	0.029	7abzR.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
14	PDB:6edtJ	0.070	0.111	3.008	109	0.061	0.119	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
15	PDB:4h56A	0.107	0.088	3.202	267	0.014	0.011	4h56A.pdb.gz
16	AFDB:P14242	0.129	0.039	4.253	873	0.112	0.027	P14242.pdb.gz	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
17	AFDB:A0A0B4JD55	0.135	0.036	4.821	1292	0.192	0.032	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
18	AFDB:A0A5F9ZH18	0.116	0.029	7.025	1109	0.154	0.030	A0A5F9ZH18.pdb.gz	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	AFDB:P14734	0.113	0.055	7.025	510	0.164	0.069	P14734.pdb.gz	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5W9	5.38e-156	432	214	1.000	1.000	RFLB_HUMAN Refilin-B OS=Homo sapiens OX=9606 GN=RFLNB PE=1 SV=1
2	Q5SVD0	2.96e-107	309	216	0.841	0.833	RFLB_MOUSE Refilin-B OS=Mus musculus OX=10090 GN=Rflnb PE=1 SV=1
3	Q6ZTI6	1.86e-29	110	216	0.407	0.403	RFLA_HUMAN Refilin-A OS=Homo sapiens OX=9606 GN=RFLNA PE=1 SV=3
4	Q7TS73	2.58e-26	102	204	0.341	0.358	RFLA_MOUSE Refilin-A OS=Mus musculus OX=10090 GN=Rflna PE=1 SV=1
5	Q9Z330	1.7	32.0	1622	0.140	0.018	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
6	P83851	2.7	31.2	314	0.070	0.048	IUNH_LEIMA Inosine-uridine preferring nucleoside hydrolase OS=Leishmania major OX=5664 GN=NSNH PE=1 SV=3
7	Q4QDN1	2.7	31.2	314	0.070	0.048	Q4QDN1_LEIMA Nonspecific nucleoside hydrolase OS=Leishmania major OX=5664 GN=NH PE=3 SV=1
8	Q21441	5.8	30.4	1066	0.084	0.017	KI26L_CAEEL Kinesin-like protein vab-8 OS=Caenorhabditis elegans OX=6239 GN=vab-8 PE=1 SV=3
9	Q8R3C6	5.8	30.4	952	0.112	0.025	RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus OX=10090 GN=Rbm19 PE=1 SV=1
10	Q7SYE7	5.9	30.4	1039	0.079	0.016	Q7SYE7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:63473 PE=2 SV=1
11	Q9VC64	6.1	30.4	1729	0.093	0.012	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
12	Q9Y4A8	6.5	30.0	694	0.084	0.026	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
13	O44224	8.2	30.0	830	0.117	0.030	O44224_DROME Miranda OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1
14	Q9VDR7	8.2	30.0	829	0.117	0.030	Q9VDR7_DROME Miranda, isoform A OS=Drosophila melanogaster OX=7227 GN=mira PE=1 SV=2
15	A0A0B4KHS3	8.4	30.0	805	0.112	0.030	A0A0B4KHS3_DROME Miranda, isoform C OS=Drosophila melanogaster OX=7227 GN=mira PE=4 SV=1
16	O45116	8.9	29.6	830	0.112	0.029	O45116_DROME Miranda OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1
17	Q8IN63	9.1	29.6	799	0.112	0.030	Q8IN63_DROME LD02989p OS=Drosophila melanogaster OX=7227 GN=mira PE=2 SV=1
18	Q811R2	9.2	29.6	1010	0.079	0.017	PRGC2_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Rattus norvegicus OX=10116 GN=Ppargc1b PE=2 SV=2
19	O75970	9.5	29.6	2070	0.107	0.011	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15068 FAM101	4.9e-87	302.8	FAM101 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9818.XP_007935624.1

Rank	PPI partner	STRING score	Description
1	9818.XP_007956553.1	0.673	V-set and immunoglobulin domain-containing protein 4
2	9818.XP_007941314.1	0.589	CD177 antigen
3	9818.XP_007935574.1	0.587	Serine/threonine-protein kinase Nek8
4	9818.XP_007935621.1	0.585	Gem-associated protein 4
5	9818.XP_007935623.1	0.584	Vacuolar protein sorting-associated protein 53 homolog
6	9818.XP_007950548.1	0.535	Asialoglycoprotein receptor 2
7	9818.XP_007943342.1	0.529	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins
8	9818.XP_007935566.1	0.528	Stromal cell-derived factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031005	1.000	filamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.972	biological regulation
GO:0032501	0.966	multicellular organismal process
GO:0048856	0.966	anatomical structure development
GO:0060284	0.958	regulation of cell development
GO:0048519	0.936	negative regulation of biological process
GO:0007275	0.924	multicellular organism development
GO:0048523	0.920	negative regulation of cellular process
GO:0061035	0.918	regulation of cartilage development
GO:0048513	0.913	animal organ development
GO:0048731	0.903	system development
GO:0007015	0.895	actin filament organization
GO:0030154	0.817	cell differentiation
GO:0009653	0.816	anatomical structure morphogenesis
GO:0001501	0.760	skeletal system development
GO:0051241	0.741	negative regulation of multicellular organismal process
GO:0030279	0.724	negative regulation of ossification
GO:0070167	0.701	regulation of biomineral tissue development
GO:0045596	0.667	negative regulation of cell differentiation
GO:0032330	0.464	regulation of chondrocyte differentiation
GO:0061572	0.464	actin filament bundle organization
GO:0061181	0.439	regulation of chondrocyte development
GO:0009888	0.400	tissue development
GO:0009887	0.342	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.999	cytoskeleton
GO:0005737	0.994	cytoplasm
GO:0015629	0.989	actin cytoskeleton
GO:0032432	0.982	actin filament bundle
GO:0043227	0.525	membrane-bounded organelle
GO:0043231	0.305	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]