StarFunc result for job id Q8N5Y2

User Input

>input (521 residues)
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWN
RSWDRWAAEDHVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEE
KDENDENSLSSSSDCSENKDEEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVL
KKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANERPRHHHVMPHANM
NVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKVTSSKFFLPIKESATS
TNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRRSTRHSANCDR
LSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKAL
LKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5Y2	1.000	1.000	3.643E-81	521	1.000	1.000	Q8N5Y2.pdb.gz	MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens OX=9606 GN=MSL3 PE=1 SV=1
2	AFDB:Q9WVG9	0.543	0.539	4.885E-71	525	0.879	0.872	Q9WVG9.pdb.gz	MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus OX=10090 GN=Msl3 PE=1 SV=3
3	AFDB:P50536	0.378	0.384	5.041E-18	512	0.250	0.254	P50536.pdb.gz	MSL3_DROME Protein male-specific lethal-3 OS=Drosophila melanogaster OX=7227 GN=msl-3 PE=1 SV=2
4	AFDB:Q59K07	0.280	0.382	4.597E-13	369	0.150	0.211	Q59K07.pdb.gz	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
5	AFDB:O96028	0.117	0.048	3.822E-3	1365	0.117	0.045	O96028.pdb.gz	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
6	PDB:3mp8A	0.093	0.094	6.872E-2	513	0.027	0.027	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
7	PDB:7pzyu	0.100	0.309	1.695E-1	130	0.033	0.131	7pzyu.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
8	AFDB:Q86BS3	0.091	0.054	1.751E-1	926	0.107	0.060	Q86BS3.pdb.gz	Q86BS3_DROME Chromator, isoform A OS=Drosophila melanogaster OX=7227 GN=Chro PE=1 SV=1
9	AFDB:Q8S949	0.070	0.046	1.947E-1	955	0.111	0.061	Q8S949.pdb.gz	KN7B_TOBAC Kinesin-like protein NACK2 OS=Nicotiana tabacum OX=4097 GN=NACK2 PE=1 SV=1
10	PDB:6tedR	0.095	0.183	5.173E-1	244	0.061	0.131	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
11	AFDB:Q38B79	0.071	0.029	5.343E-1	1702	0.134	0.041	Q38B79.pdb.gz	Q38B79_TRYB2 cAMP binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1860 PE=4 SV=1
12	PDB:6j6qF	0.067	0.167	5.455E-1	161	0.031	0.099	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
13	PDB:6g0lW	0.066	0.041	5.753E-1	878	0.027	0.016	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	AFDB:O94685	0.075	0.054	5.942E-1	829	0.115	0.072	O94685.pdb.gz	UCP8_SCHPO UBA domain-containing protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp8 PE=1 SV=2
15	PDB:3j791	0.083	0.254	6.067E-1	140	0.019	0.071	3j791.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
16	AFDB:Q7Z4V5	0.110	0.087	6.969E-1	671	0.115	0.089	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
17	PDB:1zj8A	0.081	0.078	1.088	546	0.025	0.024	1zj8A.pdb.gz	Siroheme- and [Fe4-S4]-dependent NirA from Mycobacterium tuberculosis Is a Sulfite Reductase with a Covalent Cys-Tyr Bond in the Active Site
18	PDB:4zn3A	0.086	0.268	1.148	147	0.017	0.061	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
19	PDB:3p8bB	0.085	0.263	1.419	147	0.023	0.082	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
20	PDB:4v6iBU	0.088	0.223	1.578	160	0.027	0.087	4v6iBU.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5Y2	0.0	1077	521	1.000	1.000	MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens OX=9606 GN=MSL3 PE=1 SV=1
2	Q9WVG9	0.0	908	525	0.885	0.878	MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus OX=10090 GN=Msl3 PE=1 SV=3
3	P50536	4.10e-39	151	512	0.276	0.281	MSL3_DROME Protein male-specific lethal-3 OS=Drosophila melanogaster OX=7227 GN=msl-3 PE=1 SV=2
4	B3KTM8	1.71e-20	95.1	348	0.152	0.227	B3KTM8_HUMAN Mortality factor 4 like 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
5	O13953	1.96e-20	94.7	337	0.148	0.228	EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp13 PE=1 SV=1
6	Q94C32	4.19e-19	90.5	320	0.142	0.231	MRG1_ARATH Protein MRG1 OS=Arabidopsis thaliana OX=3702 GN=MRG1 PE=1 SV=1
7	H0YMJ0	5.27e-19	88.6	245	0.134	0.286	H0YMJ0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
8	Q9UBU8	2.18e-16	83.2	362	0.161	0.232	MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=2
9	P60762	2.44e-16	82.8	362	0.161	0.232	MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus OX=10090 GN=Morf4l1 PE=1 SV=2
10	Q4V3E2	1.62e-14	77.0	327	0.131	0.208	MRG2_ARATH Protein MRG2 OS=Arabidopsis thaliana OX=3702 GN=MRG2 PE=1 SV=1
11	H0YNE0	4.96e-10	61.6	213	0.115	0.282	H0YNE0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
12	Q9Y0I1	8.37e-09	60.1	424	0.058	0.071	EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
13	Q59K07	2.35e-08	58.5	369	0.098	0.138	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
14	Q12432	2.02e-07	55.5	401	0.127	0.165	EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF3 PE=1 SV=1
15	Q15014	2.42e-07	54.7	288	0.056	0.101	MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
16	Q6QI89	3.50e-07	54.3	288	0.056	0.101	MO4L2_RAT Mortality factor 4-like protein 2 OS=Rattus norvegicus OX=10116 GN=Morf4l2 PE=2 SV=1
17	R9PY26	0.001	44.3	1864	0.027	0.008	R9PY26_DROME Hat-trick, isoform C OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=1
18	Q9VWP5	0.002	43.9	2486	0.029	0.006	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
19	Q5JXX2	0.004	40.8	177	0.033	0.096	Q5JXX2_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
20	A2CG63	0.005	42.4	1314	0.046	0.018	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	21	16.4	Chromo (CHRromatin Organisation MOdifier) domain
2	PF05712 MRG	9.9e-75	261.9	MRG
3	PF11717 Tudor-knot	0.00063	30.9	RNA binding activity-knot of a chromodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311827	0.999	E3 ubiquitin-protein ligase MSL2
2	9606.ENSP00000406037	0.999	Histone acetyltransferase KAT8
3	9606.ENSP00000462945	0.999	Male-specific lethal 1 homolog
4	9606.ENSP00000244537	0.964	Histone cluster 1 H4 family member f
5	9606.ENSP00000320566	0.955	Inhibitor of growth protein 3
6	9606.ENSP00000361363	0.952	DNA methyltransferase 1-associated protein 1
7	9606.ENSP00000340330	0.949	Histone acetyltransferase KAT5
8	9606.ENSP00000263062	0.947	Enhancer of polycomb homolog 1
9	9606.ENSP00000352925	0.942	Transformation/transcription domain-associated protein
10	9606.ENSP00000362166	0.941	Chromatin modification-related protein MEAF6
11	9606.ENSP00000247843	0.935	YEATS domain-containing protein 4
12	9606.ENSP00000397552	0.934	Actin-like protein 6A
13	9606.ENSP00000473172	0.931	RuvB-like 2
14	9606.ENSP00000318297	0.929	RuvB-like 1
15	9606.ENSP00000374213	0.926	E1A-binding protein p400
16	9606.ENSP00000331310	0.923	Mortality factor 4-like protein 1
17	9606.ENSP00000349960	0.914	Actin, cytoplasmic 1
18	9606.ENSP00000347168	0.912	Histone cluster 1 H4 family member j
19	9606.ENSP00000366956	0.912	Histone cluster 1 H4 family member h
20	9606.ENSP00000366974	0.912	Histone cluster 1 H4 family member b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding
GO:0010485	0.996	histone H4 acetyltransferase activity
GO:0003677	0.995	DNA binding
GO:0046972	0.951	histone H4K16 acetyltransferase activity
GO:0003682	0.363	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0019219	0.992	regulation of nucleobase-containing compound metabolic process
GO:0036211	0.988	protein modification process
GO:0009889	0.986	regulation of biosynthetic process
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0016570	0.980	histone modification
GO:0018193	0.976	peptidyl-amino acid modification
GO:0018205	0.974	peptidyl-lysine modification
GO:0043543	0.972	protein acylation
GO:0018393	0.963	internal peptidyl-lysine acetylation
GO:0043967	0.943	histone H4 acetylation
GO:0048518	0.895	positive regulation of biological process
GO:0048522	0.830	positive regulation of cellular process
GO:0009893	0.812	positive regulation of metabolic process
GO:0051173	0.778	positive regulation of nitrogen compound metabolic process
GO:0010604	0.766	positive regulation of macromolecule metabolic process
GO:0031325	0.758	positive regulation of cellular metabolic process
GO:0045935	0.509	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.399	cellular process
GO:0045893	0.330	positive regulation of DNA-templated transcription
GO:0006357	0.302	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902562	0.998	H4 histone acetyltransferase complex
GO:0072487	0.745	MSL complex
GO:0005737	0.654	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	0.997	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.997	histone acetyltransferase.

[back to server]