StarFunc result for job id Q8N5Y8

User Input

>input (322 residues)
MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLA
DASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVP
APDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRASSQLSWFSSHWFTVMISLYLL
LLLIVSVINSSAFQHFWNRAKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TMM8	0.849	0.849	2.175E-59	322	0.904	0.904	Q7TMM8.pdb.gz	PAR16_MOUSE Protein mono-ADP-ribosyltransferase PARP16 OS=Mus musculus OX=10090 GN=Parp16 PE=1 SV=2
2	AFDB:G3V9P8	0.573	0.305	4.285E-13	630	0.220	0.113	G3V9P8.pdb.gz	G3V9P8_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=3
3	AFDB:Q8N3A8	0.560	0.223	2.418E-11	854	0.217	0.082	Q8N3A8.pdb.gz	PARP8_HUMAN Protein mono-ADP-ribosyltransferase PARP8 OS=Homo sapiens OX=9606 GN=PARP8 PE=1 SV=1
4	AFDB:A0A024R318	0.399	0.255	8.557E-11	533	0.130	0.079	A0A024R318.pdb.gz
5	AFDB:A0A024R3T8	0.406	0.146	3.628E-10	1014	0.174	0.055	A0A024R3T8.pdb.gz
6	AFDB:Q57ZY1	0.389	0.233	6.237E-10	573	0.146	0.082	Q57ZY1.pdb.gz	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
7	AFDB:Q5RHR0	0.376	0.132	6.624E-10	1013	0.174	0.055	Q5RHR0.pdb.gz	PARP1_DANRE Poly [ADP-ribose] polymerase 1 OS=Danio rerio OX=7955 GN=parp1 PE=2 SV=1
8	AFDB:Q9ZP54	0.380	0.139	1.634E-9	983	0.149	0.049	Q9ZP54.pdb.gz	PARP1_ARATH Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana OX=3702 GN=PARP1 PE=1 SV=2
9	PDB:6x0lP	0.391	0.277	2.077E-9	474	0.137	0.093	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
10	AFDB:P35875	0.402	0.145	2.208E-9	994	0.146	0.047	P35875.pdb.gz	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
11	AFDB:Q11207	0.382	0.206	2.208E-9	637	0.134	0.068	Q11207.pdb.gz	PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1
12	PDB:1ikpA	0.231	0.139	8.033E-3	599	0.146	0.078	1ikpA.pdb.gz
13	PDB:5mrc1	0.121	0.114	2.800E-1	348	0.115	0.106	5mrc1.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:7nscA	0.090	0.098	6.503E-1	276	0.096	0.112	7nscA.pdb.gz
15	PDB:7wzsA	0.105	0.092	9.911E-1	434	0.115	0.085	7wzsA.pdb.gz
16	PDB:4oicA	0.085	0.126	1.118	182	0.075	0.132	4oicA.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
17	PDB:2fuqA	0.063	0.037	1.187	747	0.034	0.015	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
18	PDB:2r55A	0.129	0.178	1.187	208	0.068	0.106	2r55A.pdb.gz
19	PDB:6uqkA	0.108	0.028	1.261	2054	0.050	0.008	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
20	PDB:1konA	0.104	0.130	1.422	233	0.056	0.077	1konA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TMM8	0.0	573	322	0.904	0.904	PAR16_MOUSE Protein mono-ADP-ribosyltransferase PARP16 OS=Mus musculus OX=10090 GN=Parp16 PE=1 SV=2
2	Q8N5Y8	0.0	667	322	1.000	1.000	PAR16_HUMAN Protein mono-ADP-ribosyltransferase PARP16 OS=Homo sapiens OX=9606 GN=PARP16 PE=1 SV=2
3	G3V9P8	1.08e-08	58.5	631	0.217	0.111	G3V9P8_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=3
4	Q2NL67	3.94e-08	57.0	630	0.217	0.111	PARP6_HUMAN Protein mono-ADP-ribosyltransferase PARP6 OS=Homo sapiens OX=9606 GN=PARP6 PE=1 SV=1
5	Q8N3A8	1.82e-06	52.0	854	0.199	0.075	PARP8_HUMAN Protein mono-ADP-ribosyltransferase PARP8 OS=Homo sapiens OX=9606 GN=PARP8 PE=1 SV=1
6	A0A8I6A4Q9	1.05e-04	46.2	519	0.149	0.092	A0A8I6A4Q9_RAT Poly (ADP-ribose) polymerase family, member 6 OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=1
7	Q8I7C6	0.41	35.0	700	0.078	0.036	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
8	F1R506	2.2	32.7	713	0.137	0.062	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
9	Q54X55	6.6	31.2	804	0.062	0.025	Q54X55_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1B PE=4 SV=1
10	Q54XI2	8.0	30.8	938	0.059	0.020	Q54XI2_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1A PE=3 SV=1
11	Q9M1Q4	9.1	30.8	673	0.071	0.034	Q9M1Q4_ARATH Endonuclease or glycosyl hydrolase OS=Arabidopsis thaliana OX=3702 GN=T17J13.160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18084 ARTD15_N	6.5e-23	92.1	ARTD15 N-terminal domain
2	PF00644 PARP	4.8e-31	119.4	Poly(ADP-ribose) polymerase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000014143

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000005231	0.754	Poly (ADP-ribose) polymerase family, member 14
2	9555.ENSPANP00000018156	0.699	Poly (ADP-ribose) polymerase family, member 9
3	9555.ENSPANP00000005317	0.682	Poly (ADP-ribose) polymerase family, member 3
4	9555.ENSPANP00000009888	0.646	TCDD-inducible poly(ADP-ribose) polymerase
5	9555.ENSPANP00000011237	0.639	Poly (ADP-ribose) polymerase family, member 11
6	9555.ENSPANP00000001122	0.637	Basic helix-loop-helix family, member e41
7	9555.ENSPANP00000005796	0.627	Catalyzes the reversible isomerization between hydroxypyruvate and 2-hydroxy-3-oxopropanoate (also termed tartronate semialdehyde)
8	9555.ENSPANP00000006700	0.618	Poly (ADP-ribose) polymerase family, member 15
9	9555.ENSPANP00000000101	0.615	Uncharacterized protein
10	9555.ENSPANP00000008681	0.611	Ganglioside induced differentiation associated protein 2
11	9555.ENSPANP00000008509	0.608	H2.0-like homeobox
12	9555.ENSPANP00000019893	0.597	Poly (ADP-ribose) polymerase family, member 10
13	9555.ENSPANP00000008644	0.578	Poly (ADP-ribose) polymerase family, member 4
14	9555.ENSPANP00000011955	0.577	Poly (ADP-ribose) polymerase family, member 12
15	9555.ENSPANP00000016573	0.543	Component of oligomeric golgi complex 1
16	9555.ENSPANP00000015010	0.536	Poly [ADP-ribose] polymerase
17	9555.ENSPANP00000014550	0.535	Poly (ADP-ribose) polymerase 2
18	9555.ENSPANP00000011002	0.532	COX assembly mitochondrial protein
19	9555.ENSPANP00000000473	0.525	Hepatitis A virus cellular receptor 1
20	9555.ENSPANP00000001919	0.525	RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs. Catalyzes the formation of N(4)-acetylcytidine (ac4C) in 18S rRNA. Required for early nucleolar cleavages of precursor rRNA at sites A0, A1 and A2 during 18S rRNA synthesis. Catalyzes the formation of ac4C in serine and leucine tRNAs. Requires the tRNA- binding adapter protein THUMPD1 for full tRNA acetyltransferase activity but not for 18S rRNA acetylation

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity
GO:0043539	1.000	protein serine/threonine kinase activator activity
GO:0019899	0.999	enzyme binding
GO:0019900	0.934	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044281	0.980	small molecule metabolic process
GO:0065009	0.967	regulation of molecular function
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0036211	0.961	protein modification process
GO:0050896	0.954	response to stimulus
GO:1901576	0.950	organic substance biosynthetic process
GO:0044249	0.950	cellular biosynthetic process
GO:0019222	0.948	regulation of metabolic process
GO:0050794	0.947	regulation of cellular process
GO:1901360	0.942	organic cyclic compound metabolic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0080090	0.920	regulation of primary metabolic process
GO:0060255	0.918	regulation of macromolecule metabolic process
GO:0051716	0.917	cellular response to stimulus
GO:0071310	0.909	cellular response to organic substance
GO:0031323	0.902	regulation of cellular metabolic process
GO:0072524	0.887	pyridine-containing compound metabolic process
GO:0019362	0.853	pyridine nucleotide metabolic process
GO:0046496	0.812	nicotinamide nucleotide metabolic process
GO:0043687	0.786	post-translational protein modification
GO:0050790	0.778	regulation of catalytic activity
GO:0051338	0.771	regulation of transferase activity
GO:0051246	0.762	regulation of protein metabolic process
GO:0048522	0.709	positive regulation of cellular process
GO:0019674	0.666	NAD metabolic process
GO:0006950	0.665	response to stress
GO:0072525	0.659	pyridine-containing compound biosynthetic process
GO:0051174	0.648	regulation of phosphorus metabolic process
GO:0033554	0.520	cellular response to stress
GO:0009893	0.502	positive regulation of metabolic process
GO:0031399	0.469	regulation of protein modification process
GO:0042325	0.465	regulation of phosphorylation
GO:0001932	0.462	regulation of protein phosphorylation
GO:0042327	0.461	positive regulation of phosphorylation
GO:0048519	0.447	negative regulation of biological process
GO:0035966	0.419	response to topologically incorrect protein
GO:0030968	0.409	endoplasmic reticulum unfolded protein response
GO:0048523	0.403	negative regulation of cellular process
GO:0051173	0.402	positive regulation of nitrogen compound metabolic process
GO:0009435	0.400	NAD biosynthetic process
GO:0010604	0.398	positive regulation of macromolecule metabolic process
GO:0051347	0.392	positive regulation of transferase activity
GO:0051247	0.384	positive regulation of protein metabolic process
GO:0031401	0.364	positive regulation of protein modification process
GO:0043549	0.349	regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0031984	0.997	organelle subcompartment
GO:0031967	0.997	organelle envelope
GO:0005635	0.994	nuclear envelope
GO:0071782	0.991	endoplasmic reticulum tubular network
GO:0031981	0.929	nuclear lumen
GO:0005654	0.468	nucleoplasm
GO:0043232	0.361	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.

[back to server]