StarFunc result for job id Q8N5Z0

User Input

>input (425 residues)
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5Z0	1.000	1.000	2.288E-86	425	1.000	1.000	Q8N5Z0.pdb.gz	AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AADAT PE=1 SV=2
2	PDB:6d0aA	0.984	0.971	7.517E-78	431	1.000	0.986	6d0aA.pdb.gz
3	AFDB:Q9WVM8	0.997	0.997	6.421E-73	425	0.734	0.734	Q9WVM8.pdb.gz	AADAT_MOUSE Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Aadat PE=1 SV=1
4	AFDB:Q64602	0.998	0.998	2.668E-71	425	0.718	0.718	Q64602.pdb.gz	AADAT_RAT Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aadat PE=1 SV=1
5	AFDB:A7XRY8	0.905	0.883	1.354E-42	436	0.348	0.339	A7XRY8.pdb.gz	TDID_EMENI Aminotransferase tdiD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tdiD PE=1 SV=1
6	AFDB:Q9Y7S6	0.887	0.806	1.352E-40	470	0.341	0.309	Q9Y7S6.pdb.gz	AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC569.07 PE=3 SV=1
7	AFDB:O94570	0.877	0.779	6.266E-39	481	0.336	0.297	O94570.pdb.gz	AATR2_SCHPO Aromatic amino acid aminotransferase C1773.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1773.13 PE=3 SV=1
8	AFDB:O14192	0.868	0.782	3.427E-38	474	0.351	0.314	O14192.pdb.gz	AATR1_SCHPO Aromatic amino acid aminotransferase C56E4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56E4.03 PE=3 SV=1
9	AFDB:A0A1D8PG20	0.868	0.756	1.874E-37	491	0.339	0.293	A0A1D8PG20.pdb.gz	A0A1D8PG20_CANAL Bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO8 PE=4 SV=1
10	AFDB:P53090	0.853	0.730	2.209E-37	500	0.315	0.268	P53090.pdb.gz	ARO8_YEAST Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARO8 PE=1 SV=1
11	AFDB:Q6FTM8	0.871	0.739	2.463E-36	504	0.341	0.288	Q6FTM8.pdb.gz	Q6FTM8_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ARO8 PE=4 SV=1
12	PDB:4je5B	0.848	0.732	1.333E-35	497	0.320	0.274	4je5B.pdb.gz	Crystal structure of Saccharomyces cerevisiae Aro8, a putative alpha-aminoadipate aminotransferase.
13	PDB:6hndB	0.852	0.774	1.012E-33	470	0.289	0.262	6hndB.pdb.gz	Crystal structures of aminotransferases Aro8 and Aro9 from Candida albicans and structural insights into their properties.
14	PDB:1u08A	0.639	0.705	2.545E-20	382	0.172	0.191	1u08A.pdb.gz	Crystal structure and reactivity of YbdL from Escherichia coli identify a methionine aminotransferase function
15	PDB:2r5cB	0.666	0.675	1.058E-19	419	0.151	0.153	2r5cB.pdb.gz	Structural insight into the mechanism of substrate specificity of aedes kynurenine aminotransferase.
16	PDB:3b46B	0.647	0.647	1.058E-19	425	0.158	0.158	3b46B.pdb.gz
17	PDB:5wmlA	0.681	0.714	1.247E-19	404	0.193	0.203	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
18	PDB:2o0rA	0.669	0.734	1.553E-19	385	0.191	0.210	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
19	PDB:3fvsA	0.627	0.636	1.640E-19	419	0.158	0.160	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
20	PDB:3e2yA	0.656	0.678	9.476E-19	410	0.160	0.166	3e2yA.pdb.gz	Correction for Han et al., "Biochemical and Structural Properties of Mouse Kynurenine Aminotransferase III".

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64602	0.0	665	425	0.718	0.718	AADAT_RAT Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aadat PE=1 SV=1
2	Q8N5Z0	0.0	880	425	1.000	1.000	AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AADAT PE=1 SV=2
3	Q9WVM8	0.0	684	425	0.734	0.734	AADAT_MOUSE Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Aadat PE=1 SV=1
4	A7XRY8	4.11e-83	263	436	0.353	0.344	TDID_EMENI Aminotransferase tdiD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tdiD PE=1 SV=1
5	Q9Y7S6	1.10e-75	245	470	0.339	0.306	AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC569.07 PE=3 SV=1
6	O14192	2.08e-74	242	474	0.344	0.308	AATR1_SCHPO Aromatic amino acid aminotransferase C56E4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56E4.03 PE=3 SV=1
7	A0A1D8PG20	2.36e-71	234	491	0.341	0.295	A0A1D8PG20_CANAL Bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO8 PE=4 SV=1
8	O94570	4.51e-69	228	481	0.336	0.297	AATR2_SCHPO Aromatic amino acid aminotransferase C1773.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1773.13 PE=3 SV=1
9	Q6FTM8	3.81e-65	218	504	0.348	0.294	Q6FTM8_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ARO8 PE=4 SV=1
10	P53090	8.73e-59	201	500	0.325	0.276	ARO8_YEAST Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARO8 PE=1 SV=1
11	P38840	9.79e-42	156	513	0.254	0.211	ARO9_YEAST Aromatic amino acid aminotransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARO9 PE=1 SV=3
12	A0A1D8PMC5	6.63e-41	154	523	0.261	0.212	A0A1D8PMC5_CANAL Aromatic-amino-acid:2-oxoglutarate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO9 PE=1 SV=1
13	O52815	8.92e-16	81.3	438	0.209	0.203	HPGT_AMYOR (S)-3,5-dihydroxyphenylglycine transaminase OS=Amycolatopsis orientalis OX=31958 GN=hpgT PE=1 SV=1
14	P10356	5.02e-15	79.0	443	0.144	0.138	YEY2_YEAST Uncharacterized protein YER152C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YER152C PE=1 SV=2
15	A0A1D8PPA8	2.90e-13	73.2	415	0.151	0.154	A0A1D8PPA8_CANAL 2-aminoadipate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C600210WA PE=4 SV=1
16	Q9C969	4.55e-12	69.7	394	0.228	0.246	ISS1_ARATH Aromatic aminotransferase ISS1 OS=Arabidopsis thaliana OX=3702 GN=ISS1 PE=1 SV=1
17	Q9FN30	7.00e-11	65.9	414	0.212	0.217	TAT2_ARATH Probable aminotransferase TAT2 OS=Arabidopsis thaliana OX=3702 GN=At5g53970 PE=2 SV=1
18	Q9SIE1	1.04e-10	65.5	475	0.249	0.223	PAT_ARATH Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=PAT PE=1 SV=2
19	Q93703	2.29e-10	64.7	464	0.188	0.172	ATTY_CAEEL Tyrosine aminotransferase OS=Caenorhabditis elegans OX=6239 GN=tatn-1 PE=1 SV=1
20	P77434	3.15e-10	63.9	412	0.165	0.170	ALAC_ECOLI Glutamate-pyruvate aminotransferase AlaC OS=Escherichia coli (strain K12) OX=83333 GN=alaC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	8.9e-19	79.5	Aminotransferase class I and II
2	PF12897 Asp_aminotransf	5.3e-07	40.4	Aspartate amino-transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000016979

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000000068	0.995	Kynurenine 3-monooxygenase
2	9601.ENSPPYP00000009753	0.992	Kynurenine formamidase
3	9601.ENSPPYP00000023896	0.988	Aldehyde dehydrogenase 7 family, member A1
4	9601.ENSPPYP00000014317	0.958	Kynureninase
5	9601.ENSPPYP00000006812	0.929	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
6	9601.ENSPPYP00000024659	0.929	Uncharacterized protein
7	9601.ENSPPYP00000003298	0.904	The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity)
8	9601.ENSPPYP00000001362	0.893	Kynurenine aminotransferase 3
9	9601.ENSPPYP00000019712	0.887	2-oxoglutarate dehydrogenase (E1) component of the 2- oxoglutarate dehydrogenase complex, which mediates the decarboxylation of alpha-ketoglutarate. The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl- CoA to histone succinyltransferase KAT2A.
10	9601.ENSPPYP00000002634	0.857	2-oxoglutarate dehydrogenase-like, mitochondrial
11	9601.ENSPPYP00000022040	0.771	Kynurenine aminotransferase 1
12	9601.ENSPPYP00000020750	0.739	Pyridoxal 5'-phosphate (PLP)-binding protein, which may be involved in intracellular homeostatic regulation of pyridoxal 5'- phosphate (PLP), the active form of vitamin B6
13	9601.ENSPPYP00000004984	0.713	Branched-chain-amino-acid aminotransferase
14	9601.ENSPPYP00000011426	0.713	Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids (By similarity)
15	9601.ENSPPYP00000020986	0.702	RALY RNA binding protein-like
16	9601.ENSPPYP00000000908	0.699	Src homology 2 domain containing E
17	9601.ENSPPYP00000005761	0.694	4-hydroxyphenylpyruvate dioxygenase
18	9601.ENSPPYP00000014927	0.680	Alanine-glyoxylate aminotransferase
19	9601.ENSPPYP00000016479	0.676	Aminoadipate-semialdehyde dehydrogenase
20	9601.ENSPPYP00000013916	0.650	3-hydroxyanthranilate 3,4-dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	1.000	transaminase activity
GO:0042803	0.998	protein homodimerization activity
GO:0047536	0.832	2-aminoadipate transaminase activity
GO:0036137	0.445	kynurenine aminotransferase activity
GO:0016212	0.427	kynurenine-oxoglutarate transaminase activity
GO:0047315	0.309	kynurenine-glyoxylate transaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.998	organonitrogen compound metabolic process
GO:0044281	0.992	small molecule metabolic process
GO:0006520	0.966	amino acid metabolic process
GO:0042537	0.956	benzene-containing compound metabolic process
GO:0042180	0.924	cellular ketone metabolic process
GO:0009064	0.920	glutamine family amino acid metabolic process
GO:0043648	0.910	dicarboxylic acid metabolic process
GO:0043603	0.899	amide metabolic process
GO:0006536	0.803	glutamate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.990	intracellular organelle lumen
GO:0005829	0.943	cytosol
GO:0005759	0.909	mitochondrial matrix
GO:0031981	0.386	nuclear lumen
GO:0005654	0.346	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	1.000	Transaminases.
RHEA:12601	0.832	2-oxoglutarate + L-2-aminoadipate = 2-oxoadipate + L-glutamate
EC:2.6.1.39	0.832	2-aminoadipate transaminase.
RHEA:20964	0.427	2-oxoglutarate + L-kynurenine = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-glutamate
EC:2.6.1.7	0.427	kynurenine--oxoglutarate transaminase.
RHEA:19249	0.309	glyoxylate + L-kynurenine = 4-(2-aminophenyl)-2,4-dioxobutanoate + glycine
EC:2.6.1.63	0.309	kynurenine--glyoxylate transaminase.

[back to server]