StarFunc result for job id Q8N5Z5

User Input

>input (321 residues)
MQTPRPAMRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRL
CQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPL
IRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYG
SEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEAD
AQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAELAVRASPRPLARPQSCHPCC
YKPEAPGCEAPDHLQGLGVPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5Z5	1.000	1.000	7.925E-57	321	1.000	1.000	Q8N5Z5.pdb.gz	KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens OX=9606 GN=KCTD17 PE=1 SV=3
2	AFDB:Q8VC57	0.537	0.725	1.425E-30	234	0.467	0.641	Q8VC57.pdb.gz	KCTD5_MOUSE BTB/POZ domain-containing protein KCTD5 OS=Mus musculus OX=10090 GN=Kctd5 PE=1 SV=1
3	AFDB:Q14681	0.539	0.651	7.575E-30	263	0.445	0.544	Q14681.pdb.gz	KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens OX=9606 GN=KCTD2 PE=1 SV=3
4	AFDB:O76889	0.332	0.345	4.381E-26	308	0.364	0.380	O76889.pdb.gz	O76889_DROME EG:196F3.2 protein OS=Drosophila melanogaster OX=7227 GN=inc PE=4 SV=1
5	AFDB:Q18776	0.485	0.566	1.149E-23	271	0.315	0.373	Q18776.pdb.gz	Q18776_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=inso-1 PE=1 SV=2
6	AFDB:Q8T9K2	0.288	0.527	5.696E-13	173	0.212	0.393	Q8T9K2.pdb.gz	Q8T9K2_DROME GM03763p OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
7	AFDB:Q5XJ34	0.328	0.405	1.963E-12	257	0.146	0.183	Q5XJ34.pdb.gz	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
8	AFDB:Q8K0E1	0.327	0.367	4.125E-12	283	0.159	0.180	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
9	AFDB:Q8WVF5	0.322	0.396	8.042E-11	259	0.121	0.151	Q8WVF5.pdb.gz	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2
10	AFDB:D5SHR0	0.314	0.275	1.166E-10	367	0.165	0.144	D5SHR0.pdb.gz	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
11	PDB:7phhA	0.275	0.227	5.368E-7	396	0.106	0.086	7phhA.pdb.gz
12	PDB:7w6sB	0.278	0.205	2.094E-6	448	0.115	0.083	7w6sB.pdb.gz
13	PDB:7pquA	0.264	0.258	8.170E-6	328	0.093	0.091	7pquA.pdb.gz
14	PDB:3lutB	0.265	0.221	1.046E-5	390	0.087	0.072	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
15	PDB:7sizB	0.264	0.255	1.340E-5	334	0.093	0.090	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
16	PDB:2a79B	0.264	0.323	1.426E-5	259	0.072	0.089	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
17	PDB:7f3fA	0.265	0.192	1.614E-5	460	0.125	0.087	7f3fA.pdb.gz
18	PDB:6sgaFS	0.237	0.269	5.563E-5	277	0.100	0.116	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
19	PDB:7sszA	0.264	0.236	1.169E-4	362	0.075	0.066	7sszA.pdb.gz
20	PDB:6wcqC	0.237	0.535	5.765E-3	130	0.059	0.146	6wcqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N5Z5	0.0	659	321	1.000	1.000	KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens OX=9606 GN=KCTD17 PE=1 SV=3
2	Q8VC57	4.58e-107	313	234	0.464	0.637	KCTD5_MOUSE BTB/POZ domain-containing protein KCTD5 OS=Mus musculus OX=10090 GN=Kctd5 PE=1 SV=1
3	Q9NXV2	1.77e-106	312	234	0.464	0.637	KCTD5_HUMAN BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1
4	Q14681	4.35e-97	289	263	0.433	0.529	KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens OX=9606 GN=KCTD2 PE=1 SV=3
5	Q9W579	4.88e-67	211	211	0.336	0.512	Q9W579_DROME Insomniac, isoform B OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
6	O76889	4.65e-66	211	308	0.336	0.351	O76889_DROME EG:196F3.2 protein OS=Drosophila melanogaster OX=7227 GN=inc PE=4 SV=1
7	Q18776	1.45e-62	201	271	0.305	0.362	Q18776_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=inso-1 PE=1 SV=2
8	Q8T9K2	6.27e-39	137	173	0.209	0.387	Q8T9K2_DROME GM03763p OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
9	Q54EU5	9.18e-23	100	488	0.150	0.098	Q54EU5_DICDI BTB/POZ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=kctd9 PE=4 SV=1
10	Q7L273	1.19e-18	87.8	389	0.150	0.123	KCTD9_HUMAN BTB/POZ domain-containing protein KCTD9 OS=Homo sapiens OX=9606 GN=KCTD9 PE=1 SV=1
11	Q8BFX3	3.88e-18	87.4	815	0.153	0.060	KCTD3_MOUSE BTB/POZ domain-containing protein KCTD3 OS=Mus musculus OX=10090 GN=Kctd3 PE=1 SV=1
12	Q6P7W2	1.05e-17	85.9	704	0.171	0.078	SHKB1_MOUSE SH3KBP1-binding protein 1 OS=Mus musculus OX=10090 GN=Shkbp1 PE=1 SV=1
13	Q582M7	1.71e-17	85.5	639	0.150	0.075	Q582M7_TRYB2 BTB domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.160 PE=4 SV=1
14	Q8TBC3	1.85e-17	85.1	707	0.153	0.069	SHKB1_HUMAN SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 GN=SHKBP1 PE=1 SV=2
15	Q18986	2.42e-13	70.5	238	0.118	0.160	Q18986_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_D2045.8 PE=1 SV=2
16	D5SHR0	2.48e-12	68.9	367	0.128	0.112	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
17	Q8IDQ2	6.30e-12	68.6	726	0.118	0.052	Q8IDQ2_PLAF7 Kelch protein K13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1343700 PE=1 SV=1
18	Q8WVF5	1.74e-11	65.5	259	0.125	0.154	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2
19	O16612	3.27e-11	63.9	207	0.134	0.208	O16612_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=B0281.5 PE=1 SV=1
20	Q13829	1.20e-10	63.9	316	0.115	0.117	BACD2_HUMAN BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 OS=Homo sapiens OX=9606 GN=TNFAIP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	18	17.0	BTB/POZ domain
2	PF02214 BTB_2	7.1e-20	82.5	BTB/POZ domain
3	PF01698 SAM_LFY	4.2e+02	12.3	Floricaula / Leafy protein SAM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.993	Cullin-3
2	9606.ENSP00000216225	0.945	E3 ubiquitin-protein ligase RBX1
3	9606.ENSP00000312397	0.934	Kelch-like protein 3
4	9606.ENSP00000455785	0.925	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
5	9606.ENSP00000226225	0.923	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
6	9606.ENSP00000356230	0.922	Kelch-like protein 12
7	9606.ENSP00000209884	0.921	Kelch-like protein 20
8	9606.ENSP00000377001	0.913	Speckle-type POZ protein
9	9606.ENSP00000280098	0.912	Speckle-type POZ protein-like
10	9606.ENSP00000476795	0.912	Gigaxonin
11	9606.ENSP00000171111	0.911	Kelch-like ECH-associated protein 1
12	9606.ENSP00000401878	0.910	Kelch repeat and BTB domain-containing protein 8
13	9606.ENSP00000351933	0.905	Kelch-like protein 9
14	9606.ENSP00000284669	0.904	Kelch-like protein 41
15	9606.ENSP00000331682	0.904	Kelch-like protein 22
16	9606.ENSP00000215739	0.903	Leucine-zipper-like transcriptional regulator 1
17	9606.ENSP00000336800	0.903	Kelch-like protein 25
18	9606.ENSP00000479101	0.903	Ectoderm-neural cortex protein 1
19	9606.ENSP00000273963	0.900	Kelch-like protein 8
20	9606.ENSP00000343273	0.900	Kelch-like protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097602	1.000	cullin family protein binding
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0019538	0.990	protein metabolic process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0043632	0.983	modification-dependent macromolecule catabolic process
GO:0051603	0.983	proteolysis involved in protein catabolic process
GO:0006511	0.969	ubiquitin-dependent protein catabolic process
GO:0010498	0.924	proteasomal protein catabolic process
GO:0048518	0.918	positive regulation of biological process
GO:1902115	0.911	regulation of organelle assembly
GO:0048522	0.901	positive regulation of cellular process
GO:0051130	0.858	positive regulation of cellular component organization
GO:0031344	0.856	regulation of cell projection organization
GO:1902017	0.799	regulation of cilium assembly
GO:0050801	0.698	monoatomic ion homeostasis
GO:0010638	0.686	positive regulation of organelle organization
GO:0043161	0.679	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0055080	0.668	monoatomic cation homeostasis
GO:0044089	0.655	positive regulation of cellular component biogenesis
GO:0120034	0.652	positive regulation of plasma membrane bounded cell projection assembly
GO:1902117	0.642	positive regulation of organelle assembly
GO:0019725	0.637	cellular homeostasis
GO:0098771	0.581	inorganic ion homeostasis
GO:0055074	0.563	calcium ion homeostasis
GO:0055082	0.551	intracellular chemical homeostasis
GO:0016043	0.410	cellular component organization
GO:0006874	0.405	intracellular calcium ion homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031463	0.995	Cul3-RING ubiquitin ligase complex
GO:0005829	0.967	cytosol
GO:0043229	0.938	intracellular organelle
GO:0043227	0.879	membrane-bounded organelle
GO:0043231	0.872	intracellular membrane-bounded organelle
GO:0005634	0.821	nucleus
GO:0031981	0.496	nuclear lumen
GO:0005654	0.455	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]