StarFunc result for job id Q8N612

User Input

>input (972 residues)
MERMNWLSRLASRGPGHRIPQGANLQTPVMADPETCLMVFKNHWSQVVRILERQGPRAAP
GGADDLSAVRNHTYQMLTLLAEDRAVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELG
DGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLTLLDACGRPVPSSPALDEGLVLLL
SQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMAL
SAGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWLGVPALALF
MSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALHKTSVEEMIASTAYLELFLRS
ISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNSRLCMVSLSLFRTLLNLSCEDVLLQ
LVLRYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSLIPRCCRHHAPSPPRPEHASWARGP
GSPSVDSSSVTTVPRPSTPSRLALFLRQQSLGGSESPGPAPCSPGLSASPASSPGRRPTP
AEEPGELEDNYLEYLREARRGVDRCVRACRTWSAPYDGERPSPEPSPFGSRTKKRSLLPE
EDRNNVGEGEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGEL
LEGISEGMAGLEGFGQELRELEVALSNGGTGSESPLEPPLPLEEEEAYESFTCPPEPPGP
FLSSPLRTLNQLPSQPFTGPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRS
FLLNTNMVFQPSVKSLLQVLGSVKNKIENFAASQEDFPALLSKAKKYLIARGKLDWAEGP
AAGPAPRRSDPLVKSRRPSLGELLLRHAHSPTRARQAAQLVLQPGRDGAGLGLSGGSPGA
STPVLLTRGGAPERQGEALRVKNAVYCAVIFPEFLKELAAISQAHAVTSPFLLETSEEGS
GPLISGCGPLNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N612	1.000	1.000	0.000	972	1.000	1.000	Q8N612.pdb.gz	FHI1B_HUMAN FHF complex subunit HOOK-interacting protein 1B OS=Homo sapiens OX=9606 GN=FHIP1B PE=1 SV=3
2	AFDB:Q14674	0.124	0.068	1.876E-3	2120	0.135	0.062	Q14674.pdb.gz	ESPL1_HUMAN Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3
3	PDB:4hm9A	0.228	0.384	4.892E-3	511	0.058	0.110	4hm9A.pdb.gz
4	PDB:7wttK	0.153	0.148	5.720E-3	1022	0.068	0.065	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
5	AFDB:A3KDM3	0.079	0.071	8.290E-3	1160	0.112	0.094	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
6	PDB:3w3uA	0.165	0.158	8.794E-3	1030	0.073	0.069	3w3uA.pdb.gz
7	PDB:1b3uA	0.142	0.205	1.069E-2	588	0.048	0.080	1b3uA.pdb.gz
8	PDB:5tbkA	0.127	0.203	1.250E-2	417	0.044	0.103	5tbkA.pdb.gz
9	PDB:7a9wA	0.086	0.137	1.352E-2	513	0.055	0.103	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
10	PDB:7r5jB0	0.213	0.136	1.352E-2	1748	0.128	0.071	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
11	PDB:6n1zA	0.153	0.154	1.520E-2	961	0.060	0.060	6n1zA.pdb.gz
12	AFDB:M9PE53	0.113	0.106	1.550E-2	1069	0.140	0.127	M9PE53.pdb.gz	M9PE53_DROME Multiple wing hairs, isoform C OS=Drosophila melanogaster OX=7227 GN=mwh PE=4 SV=1
13	PDB:3nd2A	0.164	0.181	1.581E-2	861	0.064	0.072	3nd2A.pdb.gz
14	PDB:4bsmA	0.151	0.160	1.644E-2	896	0.053	0.058	4bsmA.pdb.gz
15	AFDB:O14607	0.076	0.062	2.203E-2	1347	0.105	0.076	O14607.pdb.gz	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
16	AFDB:Q9SY69	0.081	0.085	2.477E-2	913	0.108	0.115	Q9SY69.pdb.gz	PPR29_ARATH Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
17	AFDB:G5EB36	0.108	0.117	3.809E-2	867	0.111	0.125	G5EB36.pdb.gz	G5EB36_EMENI Zn(2)-C6 fungal-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00689 PE=4 SV=1
18	AFDB:Q5RJA1	0.072	0.077	6.089E-2	848	0.085	0.098	Q5RJA1.pdb.gz	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2
19	AFDB:Q8LPF0	0.110	0.084	6.585E-2	1390	0.106	0.074	Q8LPF0.pdb.gz	TAF2_ARATH Transcription initiation factor TFIID subunit 2 OS=Arabidopsis thaliana OX=3702 GN=TAF2 PE=2 SV=1
20	AFDB:Q6A070	0.124	0.079	1.384E-1	1776	0.107	0.059	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N612	0.0	1941	972	1.000	1.000	FHI1B_HUMAN FHF complex subunit HOOK-interacting protein 1B OS=Homo sapiens OX=9606 GN=FHIP1B PE=1 SV=3
2	Q05DH4	1.21e-171	530	1040	0.284	0.265	FHI1A_HUMAN FHF complex subunit HOOK-interacting protein 1A OS=Homo sapiens OX=9606 GN=FHIP1A PE=1 SV=2
3	Q5W0V3	1.14e-11	71.2	765	0.061	0.077	FHI2A_HUMAN FHF complex subunit HOOK interacting protein 2A OS=Homo sapiens OX=9606 GN=FHIP2A PE=1 SV=1
4	Q5ZJE0	4.0	33.9	794	0.024	0.029	Q5ZJE0_CHICK Ubiquitin carboxyl-terminal hydrolase OS=Gallus gallus OX=9031 GN=RCJMB04_19b7 PE=2 SV=1
5	Q3URR7	4.1	33.9	782	0.025	0.031	ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus OX=10090 GN=Zscan10 PE=1 SV=2
6	Q8CF60	4.1	33.5	680	0.029	0.041	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
7	O14978	4.9	33.5	683	0.029	0.041	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
8	D9PTP5	8.8	32.3	478	0.036	0.073	D9PTP5_CAEEL PX domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snx-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19314 DUF5917	1e-34	129.9	Family of unknown function (DUF5917)
2	PF19311 KELAA	1.1e-07	42.7	KELAA motif
3	PF10257 RAI16-like	8.1e-93	322.8	Retinoic acid induced 16-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305699	0.997	Protein Hook homolog 3
2	9606.ENSP00000378152	0.996	AKT-interacting protein
3	9606.ENSP00000360252	0.983	Protein Hook homolog 1
4	9606.ENSP00000380785	0.955	Protein Hook homolog 2
5	9606.ENSP00000365048	0.861	Tumor necrosis factor ligand superfamily member 13B
6	9606.ENSP00000220509	0.638	Vacuolar protein sorting-associated protein 18 homolog
7	9606.ENSP00000459043	0.633	BICD family-like cargo adapter 2
8	9606.ENSP00000320821	0.612	Kinesin-like protein KIF1C
9	9606.ENSP00000259632	0.602	Dynactin subunit 3
10	9606.ENSP00000278886	0.602	Ninein-like protein
11	9606.ENSP00000347486	0.502	MORN repeat containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007040	0.993	lysosome organization
GO:0007032	0.993	endosome organization
GO:0008333	0.992	endosome to lysosome transport
GO:0016482	0.990	cytosolic transport
GO:0008104	0.935	protein localization
GO:0045022	0.484	early endosome to late endosome transport
GO:1905719	0.403	protein localization to perinuclear region of cytoplasm
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0043229	0.945	intracellular organelle
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0005829	0.901	cytosol
GO:0016020	0.588	membrane
GO:0070695	0.510	FHF complex
GO:0043228	0.482	non-membrane-bounded organelle
GO:0012505	0.397	endomembrane system
GO:0043232	0.347	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]