StarFunc result for job id Q8N668

User Input

>input (190 residues)
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILK
SIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLR
GLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE
SISTLISQPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N668	1.000	1.000	1.374E-35	190	1.000	1.000	Q8N668.pdb.gz	COMD1_HUMAN COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1 PE=1 SV=1
2	AFDB:Q8K4M5	0.644	0.651	2.360E-28	188	0.837	0.846	Q8K4M5.pdb.gz	COMD1_MOUSE COMM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Commd1 PE=1 SV=2
3	AFDB:Q9Y6G5	0.481	0.458	2.009E-9	202	0.142	0.134	Q9Y6G5.pdb.gz	COMDA_HUMAN COMM domain-containing protein 10 OS=Homo sapiens OX=9606 GN=COMMD10 PE=1 SV=1
4	AFDB:Q9NX08	0.427	0.441	3.240E-9	183	0.158	0.164	Q9NX08.pdb.gz	COMD8_HUMAN COMM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=COMMD8 PE=1 SV=1
5	AFDB:Q8K2Q0	0.484	0.476	6.633E-9	198	0.179	0.172	Q8K2Q0.pdb.gz	COMD9_MOUSE COMM domain-containing protein 9 OS=Mus musculus OX=10090 GN=Commd9 PE=1 SV=3
6	AFDB:Q53FR9	0.433	0.418	7.474E-9	198	0.174	0.167	Q53FR9.pdb.gz	Q53FR9_HUMAN COMM domain containing 9 variant (Fragment) OS=Homo sapiens OX=9606 GN=COMMD9 PE=2 SV=1
7	AFDB:H3BM91	0.522	0.481	1.135E-8	211	0.163	0.147	H3BM91.pdb.gz	H3BM91_HUMAN COMM domain containing 4 (Fragment) OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
8	AFDB:Q9UBI1	0.462	0.451	2.324E-8	195	0.111	0.108	Q9UBI1.pdb.gz	COMD3_HUMAN COMM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=COMMD3 PE=1 SV=1
9	AFDB:Q86VX2	0.464	0.444	6.808E-8	200	0.163	0.155	Q86VX2.pdb.gz	COMD7_HUMAN COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2
10	AFDB:Q86X83	0.394	0.379	6.808E-8	199	0.142	0.136	Q86X83.pdb.gz	COMD2_HUMAN COMM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=COMMD2 PE=1 SV=2
11	PDB:1cqxA	0.199	0.116	3.231E-2	403	0.105	0.050	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
12	PDB:4q35B	0.145	0.169	1.526E-1	150	0.063	0.080	4q35B.pdb.gz	Structural basis for lipopolysaccharide insertion in the bacterial outer membrane.
13	PDB:1gvhA	0.174	0.109	1.620E-1	396	0.105	0.051	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
14	PDB:6xywBd	0.176	0.158	1.938E-1	216	0.042	0.037	6xywBd.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
15	PDB:5oqmd	0.182	0.087	2.460E-1	442	0.079	0.034	5oqmd.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
16	PDB:7bxtM	0.120	0.116	2.772E-1	198	0.058	0.056	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
17	PDB:5iv5BD	0.152	0.213	2.943E-1	126	0.095	0.143	5iv5BD.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:1xdxA	0.123	0.176	3.124E-1	114	0.079	0.132	1xdxA.pdb.gz
19	PDB:4gouA	0.152	0.079	3.520E-1	507	0.116	0.043	4gouA.pdb.gz
20	PDB:3e20B	0.123	0.093	4.470E-1	261	0.079	0.057	3e20B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N668	1.98e-140	390	190	1.000	1.000	COMD1_HUMAN COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1 PE=1 SV=1
2	Q8K4M5	1.27e-116	330	188	0.837	0.846	COMD1_MOUSE COMM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Commd1 PE=1 SV=2
3	A0A0B4J287	1.3	31.6	177	0.158	0.169	A0A0B4J287_HUMAN COMM domain containing 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
4	Q7LHG5	1.6	32.0	1498	0.084	0.011	YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2
5	Q9H0A8	1.9	31.2	199	0.158	0.151	COMD4_HUMAN COMM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
6	Q99315	2.5	31.2	1547	0.084	0.010	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
7	H3BM91	3.5	30.4	211	0.126	0.114	H3BM91_HUMAN COMM domain containing 4 (Fragment) OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1
8	Q54P51	7.1	29.6	539	0.084	0.030	CPNC_DICDI Copine-C OS=Dictyostelium discoideum OX=44689 GN=cpnC PE=2 SV=1
9	O49397	8.3	29.6	552	0.111	0.038	ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana OX=3702 GN=ARR10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17221 COMMD1_N	7.8e-41	149.9	COMMD1 N-terminal domain
2	PF07258 COMM_domain	1.7e-05	36.4	COMM domain
3	PF14771 DUF4476	2.7e+02	13.2	Domain of unknown function (DUF4476)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308236

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444856	0.999	Cullin-2
2	9606.ENSP00000365401	0.994	Coiled-coil domain-containing protein 22
3	9606.ENSP00000274458	0.990	COMM domain-containing protein 10
4	9606.ENSP00000242839	0.982	Copper-transporting ATPase 2
5	9606.ENSP00000419475	0.980	COMM domain-containing protein 2
6	9606.ENSP00000348054	0.973	COMM domain containing 6
7	9606.ENSP00000394331	0.972	COMM domain-containing protein 5
8	9606.ENSP00000267935	0.970	COMM domain-containing protein 4
9	9606.ENSP00000278980	0.967	COMM domain-containing protein 7
10	9606.ENSP00000366032	0.959	COMM domain-containing protein 3
11	9606.ENSP00000370984	0.951	COMM domain-containing protein 8
12	9606.ENSP00000360242	0.948	E3 ubiquitin-protein ligase XIAP
13	9606.ENSP00000365477	0.938	Coiled-coil domain-containing protein 93
14	9606.ENSP00000262306	0.936	Elongin-B
15	9606.ENSP00000263401	0.934	COMM domain-containing protein 9
16	9606.ENSP00000384273	0.932	Transcription factor p65
17	9606.ENSP00000321388	0.927	Ankyrin repeat and SOCS box protein 4
18	9606.ENSP00000251143	0.921	UPF0505 protein C16orf62
19	9606.ENSP00000216225	0.920	E3 ubiquitin-protein ligase RBX1
20	9606.ENSP00000350512	0.915	COP9 signalosome complex subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0080025	0.842	phosphatidylinositol-3,5-bisphosphate binding
GO:0017080	0.841	sodium channel regulator activity
GO:0070300	0.837	phosphatidic acid binding
GO:0008200	0.837	ion channel inhibitor activity
GO:0005547	0.836	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005546	0.836	phosphatidylinositol-4,5-bisphosphate binding
GO:0043325	0.829	phosphatidylinositol-3,4-bisphosphate binding
GO:0019871	0.826	sodium channel inhibitor activity
GO:0005507	0.822	copper ion binding
GO:0046983	0.747	protein dimerization activity
GO:0042803	0.744	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048518	0.928	positive regulation of biological process
GO:0048519	0.900	negative regulation of biological process
GO:0051179	0.878	localization
GO:0071704	0.862	organic substance metabolic process
GO:0044238	0.836	primary metabolic process
GO:0006807	0.810	nitrogen compound metabolic process
GO:0043170	0.799	macromolecule metabolic process
GO:0032880	0.779	regulation of protein localization
GO:0048523	0.755	negative regulation of cellular process
GO:0044237	0.716	cellular metabolic process
GO:0051171	0.713	regulation of nitrogen compound metabolic process
GO:0080090	0.709	regulation of primary metabolic process
GO:0060255	0.705	regulation of macromolecule metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0009893	0.650	positive regulation of metabolic process
GO:0050896	0.622	response to stimulus
GO:0051716	0.583	cellular response to stimulus
GO:0010604	0.569	positive regulation of macromolecule metabolic process
GO:0048878	0.557	chemical homeostasis
GO:0051641	0.557	cellular localization
GO:0051246	0.552	regulation of protein metabolic process
GO:0051173	0.550	positive regulation of nitrogen compound metabolic process
GO:0051049	0.521	regulation of transport
GO:0051234	0.506	establishment of localization
GO:0010468	0.506	regulation of gene expression
GO:0031326	0.506	regulation of cellular biosynthetic process
GO:0019219	0.496	regulation of nucleobase-containing compound metabolic process
GO:0044260	0.493	cellular macromolecule metabolic process
GO:0006810	0.488	transport
GO:0010556	0.468	regulation of macromolecule biosynthetic process
GO:0051252	0.461	regulation of RNA metabolic process
GO:0048522	0.387	positive regulation of cellular process
GO:1901564	0.369	organonitrogen compound metabolic process
GO:0051247	0.328	positive regulation of protein metabolic process
GO:2001141	0.316	regulation of RNA biosynthetic process
GO:0006355	0.314	regulation of DNA-templated transcription
GO:0019538	0.304	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0005654	0.996	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0005829	0.979	cytosol
GO:0000151	0.875	ubiquitin ligase complex
GO:0031461	0.838	cullin-RING ubiquitin ligase complex
GO:0031462	0.385	Cul2-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]