StarFunc result for job id Q8N684

User Input

>input (471 residues)
MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N684	1.000	1.000	6.089E-72	471	1.000	1.000	Q8N684.pdb.gz	CPSF7_HUMAN Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 PE=1 SV=1
2	AFDB:F8WJN3	0.215	0.212	9.236E-33	478	0.459	0.452	F8WJN3.pdb.gz	F8WJN3_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=1
3	AFDB:Q16630	0.241	0.209	4.078E-30	551	0.469	0.401	Q16630.pdb.gz	CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2
4	AFDB:Q62029	0.162	0.122	1.205E-8	628	0.125	0.094	Q62029.pdb.gz	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
5	AFDB:Q8BIF2	0.162	0.202	1.357E-8	374	0.130	0.163	Q8BIF2.pdb.gz	RFOX3_MOUSE RNA binding protein fox-1 homolog 3 OS=Mus musculus OX=10090 GN=Rbfox3 PE=1 SV=2
6	AFDB:E7ERJ7	0.164	0.129	3.528E-8	604	0.125	0.098	E7ERJ7.pdb.gz	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
7	AFDB:A0A024R9C1	0.163	0.123	4.220E-8	636	0.125	0.093	A0A024R9C1.pdb.gz
8	AFDB:Q6PHQ9	0.161	0.117	4.220E-8	660	0.130	0.092	Q6PHQ9.pdb.gz	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
9	AFDB:Q9FMG4	0.171	0.260	6.039E-8	303	0.132	0.205	Q9FMG4.pdb.gz	SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana OX=3702 GN=SC35 PE=1 SV=1
10	AFDB:Q98SP8	0.161	0.121	1.034E-7	629	0.104	0.078	Q98SP8.pdb.gz	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
11	PDB:5yzg1	0.158	0.301	3.087E-6	243	0.030	0.058	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:5gm6V	0.158	0.542	9.043E-6	128	0.047	0.172	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7evoD	0.166	0.372	1.219E-5	200	0.049	0.115	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
14	PDB:5xjcw	0.172	0.805	1.294E-5	91	0.036	0.187	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
15	PDB:6y53o	0.155	0.435	1.744E-5	160	0.042	0.125	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:6qw6R	0.165	0.648	1.965E-5	106	0.034	0.151	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:6gd1A	0.156	0.373	2.086E-5	190	0.028	0.068	6gd1A.pdb.gz
18	PDB:7dvqY	0.164	0.527	2.351E-5	140	0.032	0.107	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7ohxo	0.158	0.597	2.649E-5	112	0.040	0.170	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
20	PDB:5lsbA	0.157	0.405	2.985E-5	176	0.036	0.097	5lsbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N684	0.0	949	471	1.000	1.000	CPSF7_HUMAN Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 PE=1 SV=1
2	Q6NVF9	3.69e-46	170	551	0.185	0.158	CPSF6_MOUSE Cleavage and polyadenylation specificity factor subunit 6 OS=Mus musculus OX=10090 GN=Cpsf6 PE=1 SV=1
3	Q16630	3.76e-46	170	551	0.185	0.158	CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2
4	F8WJN3	1.73e-40	153	478	0.206	0.203	F8WJN3_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=1
5	Q9VSH4	1.38e-25	112	652	0.136	0.098	CPSF6_DROME Cleavage and polyadenylation specificity factor subunit 6 OS=Drosophila melanogaster OX=7227 GN=Cpsf6 PE=1 SV=2
6	Q9LIS2	3.48e-08	54.3	136	0.072	0.250	RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG4 PE=1 SV=1
7	Q9SVM8	6.54e-06	48.5	158	0.068	0.203	RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBG2 PE=1 SV=1
8	Q43472	1.09e-05	47.8	161	0.051	0.149	GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare OX=4513 GN=blt801 PE=1 SV=1
9	J7FTI7	5.71e-05	45.8	162	0.051	0.148	J7FTI7_HORVU RBP1 OS=Hordeum vulgare OX=4513 GN=rbp1 PE=1 SV=1
10	Q43349	7.79e-05	47.0	342	0.055	0.076	CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29A PE=2 SV=2
11	F4JAF3	1.05e-04	46.6	363	0.055	0.072	F4JAF3_ARATH Chloroplast RNA-binding protein 29 OS=Arabidopsis thaliana OX=3702 GN=CP29 PE=1 SV=1
12	Q5AB84	1.59e-04	46.2	400	0.053	0.062	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
13	Q03251	1.61e-04	44.7	169	0.049	0.136	RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=RBG8 PE=1 SV=1
14	P48809	1.64e-04	46.2	421	0.064	0.071	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
15	A0A0A0LLY1	0.001	42.0	160	0.047	0.138	SRBP1_CUCSA Small RNA binding protein 1 OS=Cucumis sativus OX=3659 GN=SRBP1 PE=1 SV=1
16	Q9FFZ6	0.001	41.6	146	0.059	0.192	RBP11_ARATH Small RNA-binding protein 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=S-RBP11 PE=2 SV=1
17	Q9ZUU4	0.001	43.5	289	0.055	0.090	CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
18	Q9ZUJ3	0.002	42.4	258	0.059	0.109	Q9ZUJ3_ARATH AT1G60000 protein OS=Arabidopsis thaliana OX=3702 GN=At1g60000 PE=1 SV=1
19	Q03250	0.003	40.8	176	0.047	0.125	RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana OX=3702 GN=RBG7 PE=1 SV=1
20	P84586	0.009	40.8	388	0.045	0.054	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	0.015	26.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345412

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300291	0.999	Cleavage and polyadenylation specificity factor subunit 5
2	9606.ENSP00000266679	0.989	Cleavage and polyadenylation specificity factor subunit 6
3	9606.ENSP00000238112	0.974	Cleavage and polyadenylation specificity factor subunit 3
4	9606.ENSP00000484669	0.974	Cleavage and polyadenylation specificity factor subunit 1
5	9606.ENSP00000298875	0.972	Cleavage and polyadenylation specificity factor subunit 2
6	9606.ENSP00000362063	0.969	Cleavage stimulation factor subunit 2
7	9606.ENSP00000292476	0.957	Cleavage and polyadenylation specificity factor subunit 4
8	9606.ENSP00000307863	0.945	Splicing factor U2AF 65 kDa subunit
9	9606.ENSP00000217109	0.868	Cleavage stimulation factor subunit 1
10	9606.ENSP00000245934	0.866	Symplekin
11	9606.ENSP00000315791	0.863	Cleavage stimulation factor subunit 3
12	9606.ENSP00000298281	0.848	Pre-mRNA cleavage complex 2 protein Pcf11
13	9606.ENSP00000216277	0.836	Poly(A) polymerase alpha
14	9606.ENSP00000325377	0.825	pre-mRNA 3' end processing protein WDR33
15	9606.ENSP00000332444	0.812	Cleavage stimulation factor subunit 2 tau variant
16	9606.ENSP00000216727	0.794	Polyadenylate-binding protein 2
17	9606.ENSP00000364289	0.781	Nuclear cap-binding protein subunit 1
18	9606.ENSP00000336752	0.775	Pre-mRNA 3'-end-processing factor FIP1
19	9606.ENSP00000326261	0.763	Serine/arginine repetitive matrix protein 1
20	9606.ENSP00000359988	0.744	Serine/arginine-rich splicing factor 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0010467	0.989	gene expression
GO:0016070	0.989	RNA metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0006396	0.981	RNA processing
GO:0065003	0.969	protein-containing complex assembly
GO:0006397	0.967	mRNA processing
GO:0050684	0.963	regulation of mRNA processing
GO:0031124	0.957	mRNA 3'-end processing
GO:0071826	0.945	ribonucleoprotein complex subunit organization
GO:0022613	0.925	ribonucleoprotein complex biogenesis
GO:0090305	0.924	nucleic acid phosphodiester bond hydrolysis
GO:0051259	0.879	protein complex oligomerization
GO:0090501	0.872	RNA phosphodiester bond hydrolysis
GO:0051262	0.794	protein tetramerization
GO:0051291	0.773	protein heterooligomerization
GO:0022618	0.763	ribonucleoprotein complex assembly
GO:0031440	0.368	regulation of mRNA 3'-end processing
GO:0010468	0.356	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0140513	0.997	nuclear protein-containing complex
GO:0005849	0.990	mRNA cleavage factor complex
GO:0005847	0.973	mRNA cleavage and polyadenylation specificity factor complex
GO:0016604	0.591	nuclear body
GO:0005829	0.427	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]