StarFunc result for job id Q8N697

User Input

>input (577 residues)
MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVL
FLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAF
PLLAAPATRAALCGSARLLNCTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGA
DQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTVCVGLAFVVF
LCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCK
MSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTT
PHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAG
ILESKRLNLVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAA
PKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLA
AIQGATLLLFLIISVKYDHHRDHQRSRANGVPTSRRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N697	1.000	1.000	1.418E-78	577	1.000	1.000	Q8N697.pdb.gz	S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens OX=9606 GN=SLC15A4 PE=1 SV=1
2	AFDB:Q91W98	0.910	0.914	1.044E-65	574	0.849	0.854	Q91W98.pdb.gz	S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus OX=10090 GN=Slc15a4 PE=1 SV=1
3	AFDB:Q8IY34	0.812	0.806	1.438E-42	581	0.485	0.482	Q8IY34.pdb.gz	S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens OX=9606 GN=SLC15A3 PE=1 SV=2
4	AFDB:Q924V4	0.827	0.820	2.364E-41	582	0.489	0.485	Q924V4.pdb.gz	S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus OX=10116 GN=Slc15a3 PE=2 SV=1
5	AFDB:Q9M390	0.723	0.732	8.100E-26	570	0.265	0.268	Q9M390.pdb.gz	PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana OX=3702 GN=NPF8.1 PE=1 SV=1
6	AFDB:Q9LFB8	0.731	0.739	9.182E-26	570	0.282	0.286	Q9LFB8.pdb.gz	PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana OX=3702 GN=NPF8.2 PE=2 SV=1
7	AFDB:Q9LVE0	0.729	0.714	2.293E-24	590	0.267	0.261	Q9LVE0.pdb.gz	PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana OX=3702 GN=NPF6.4 PE=1 SV=1
8	AFDB:Q93Z20	0.669	0.656	2.599E-24	590	0.265	0.259	Q93Z20.pdb.gz	PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana OX=3702 GN=NPF8.5 PE=2 SV=1
9	AFDB:Q9FNL8	0.752	0.741	4.864E-24	586	0.258	0.254	Q9FNL8.pdb.gz	PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana OX=3702 GN=NPF5.3 PE=2 SV=1
10	AFDB:Q9M9V7	0.751	0.739	1.076E-23	587	0.227	0.223	Q9M9V7.pdb.gz	PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana OX=3702 GN=NPF2.9 PE=1 SV=1
11	PDB:4oh3A	0.728	0.816	6.327E-20	512	0.232	0.262	4oh3A.pdb.gz
12	PDB:4oh3B	0.728	0.779	9.568E-19	537	0.236	0.253	4oh3B.pdb.gz
13	PDB:5a2oA	0.711	0.865	1.080E-17	470	0.236	0.289	5a2oA.pdb.gz	Molecular Basis of Nitrate Uptake by the Plant Nitrate Transporter Nrt1.1.
14	PDB:7pmyA	0.697	0.617	6.247E-17	657	0.211	0.186	7pmyA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
15	PDB:7nqkA	0.579	0.518	7.993E-16	658	0.203	0.178	7nqkA.pdb.gz
16	PDB:6gs1A	0.555	0.662	5.196E-13	472	0.154	0.189	6gs1A.pdb.gz
17	PDB:6fmrA	0.572	0.681	5.649E-13	475	0.163	0.198	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
18	PDB:7pmxA	0.599	0.535	7.258E-13	657	0.189	0.166	7pmxA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
19	PDB:5oxpA	0.511	0.625	1.606E-12	462	0.173	0.216	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
20	PDB:4q65A	0.508	0.650	2.124E-9	437	0.140	0.185	4q65A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09014	0.0	922	572	0.861	0.869	S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus OX=10116 GN=Slc15a4 PE=1 SV=1
2	Q8N697	0.0	1171	577	1.000	1.000	S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens OX=9606 GN=SLC15A4 PE=1 SV=1
3	Q91W98	0.0	908	574	0.861	0.866	S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus OX=10090 GN=Slc15a4 PE=1 SV=1
4	Q8IY34	5.69e-164	481	581	0.501	0.497	S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens OX=9606 GN=SLC15A3 PE=1 SV=2
5	Q924V4	1.58e-161	475	582	0.490	0.486	S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus OX=10116 GN=Slc15a3 PE=2 SV=1
6	Q8BPX9	7.31e-158	465	578	0.487	0.486	S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus OX=10090 GN=Slc15a3 PE=2 SV=1
7	F5GZ36	9.40e-135	402	448	0.381	0.491	F5GZ36_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens OX=9606 GN=SLC15A3 PE=1 SV=2
8	F5H251	1.47e-126	379	394	0.352	0.515	F5H251_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens OX=9606 GN=SLC15A3 PE=1 SV=2
9	F5H1C8	5.09e-85	274	456	0.295	0.373	F5H1C8_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens OX=9606 GN=SLC15A3 PE=1 SV=2
10	Q9LFB8	4.71e-70	238	570	0.295	0.298	PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana OX=3702 GN=NPF8.2 PE=2 SV=1
11	Q84WG0	3.85e-65	224	545	0.276	0.292	PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana OX=3702 GN=NPF8.4 PE=2 SV=2
12	Q93Z20	8.92e-64	221	590	0.286	0.280	PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana OX=3702 GN=NPF8.5 PE=2 SV=1
13	Q9M390	1.03e-63	221	570	0.288	0.291	PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana OX=3702 GN=NPF8.1 PE=1 SV=1
14	P46032	1.06e-59	210	585	0.284	0.280	PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana OX=3702 GN=NPF8.3 PE=1 SV=1
15	Q9LVE0	4.48e-55	197	590	0.282	0.276	PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana OX=3702 GN=NPF6.4 PE=1 SV=1
16	Q9FNL7	2.59e-49	182	582	0.248	0.246	PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana OX=3702 GN=NPF5.2 PE=2 SV=1
17	Q9LFR1	8.90e-48	177	552	0.253	0.264	PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana OX=3702 GN=NPF5.8 PE=2 SV=1
18	Q9FNL8	9.25e-48	177	586	0.267	0.263	PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana OX=3702 GN=NPF5.3 PE=2 SV=1
19	Q8VZR7	1.65e-46	174	583	0.289	0.286	PTR30_ARATH Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana OX=3702 GN=NPF5.1 PE=2 SV=2
20	Q9C7U1	1.91e-46	173	555	0.251	0.261	PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana OX=3702 GN=NPF5.12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	6e-09	46.9	Major Facilitator Superfamily
2	PF12832 MFS_1_like	26	15.1	MFS_1 like family
3	PF00854 PTR2	4.3e-116	399.6	POT family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368245	0.838	Uncharacterized protein CXorf21
2	9606.ENSP00000372390	0.736	Cationic amino acid transporter 4
3	9606.ENSP00000253329	0.705	Peptidyl-prolyl cis-trans isomerase-like 4
4	9606.ENSP00000340761	0.705	BRI3-binding protein
5	9606.ENSP00000281703	0.701	Glycosyltransferase 1 domain-containing protein 1
6	9606.ENSP00000311135	0.667	Probable ATP-dependent RNA helicase DHX37
7	9606.ENSP00000292807	0.658	AP-2 complex subunit mu
8	9606.ENSP00000408581	0.650	Transmembrane protein 132D
9	9606.ENSP00000410852	0.650	Transmembrane protein 132C
10	9606.ENSP00000263512	0.637	P3 protein
11	9606.ENSP00000360966	0.627	Solute carrier family 2, facilitated glucose transporter member 6
12	9606.ENSP00000299308	0.613	Transmembrane protein 132B
13	9606.ENSP00000222823	0.593	Nucleotide-binding oligomerization domain-containing protein 1
14	9606.ENSP00000387694	0.584	Solute carrier family 12 member 5
15	9606.ENSP00000353874	0.577	Toll-like receptor 9
16	9606.ENSP00000215793	0.568	Splicing factor 3A subunit 1
17	9606.ENSP00000272542	0.567	Sodium-dependent phosphate transporter 1
18	9606.ENSP00000259089	0.563	Tyrosine-protein kinase Blk
19	9606.ENSP00000324842	0.563	Acetoacetyl-CoA synthetase
20	9606.ENSP00000300589	0.559	Nucleotide-binding oligomerization domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901474	1.000	azole transmembrane transporter activity
GO:1904680	1.000	peptide transmembrane transporter activity
GO:0015179	1.000	L-amino acid transmembrane transporter activity
GO:0015174	1.000	basic amino acid transmembrane transporter activity
GO:0015173	1.000	aromatic amino acid transmembrane transporter activity
GO:0015295	0.999	solute:proton symporter activity
GO:0035673	0.981	oligopeptide transmembrane transporter activity
GO:0005515	0.971	protein binding
GO:0071916	0.970	dipeptide transmembrane transporter activity
GO:1901505	0.609	carbohydrate derivative transmembrane transporter activity
GO:1901702	0.402	salt transmembrane transporter activity
GO:0005290	0.396	L-histidine transmembrane transporter activity
GO:0015333	0.392	peptide:proton symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0071705	0.991	nitrogen compound transport
GO:0009987	0.988	cellular process
GO:0071702	0.981	organic substance transport
GO:0050789	0.967	regulation of biological process
GO:0048583	0.901	regulation of response to stimulus
GO:0050794	0.886	regulation of cellular process
GO:0048518	0.842	positive regulation of biological process
GO:0048522	0.791	positive regulation of cellular process
GO:0002682	0.718	regulation of immune system process
GO:0055085	0.692	transmembrane transport
GO:0048584	0.652	positive regulation of response to stimulus
GO:0032101	0.648	regulation of response to external stimulus
GO:0023051	0.579	regulation of signaling
GO:0010646	0.579	regulation of cell communication
GO:0031347	0.570	regulation of defense response
GO:0002831	0.565	regulation of response to biotic stimulus
GO:0002684	0.558	positive regulation of immune system process
GO:0050776	0.555	regulation of immune response
GO:0050778	0.542	positive regulation of immune response
GO:0045088	0.526	regulation of innate immune response
GO:0031349	0.525	positive regulation of defense response
GO:0045089	0.521	positive regulation of innate immune response
GO:0009966	0.510	regulation of signal transduction
GO:0023056	0.470	positive regulation of signaling
GO:0010647	0.470	positive regulation of cell communication
GO:0009967	0.455	positive regulation of signal transduction
GO:0015711	0.426	organic anion transport
GO:0046942	0.418	carboxylic acid transport
GO:0062207	0.372	regulation of pattern recognition receptor signaling pathway
GO:0062208	0.363	positive regulation of pattern recognition receptor signaling pathway
GO:0050896	0.310	response to stimulus
GO:0006865	0.303	amino acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0098588	0.995	bounding membrane of organelle
GO:0005765	0.990	lysosomal membrane
GO:0005768	0.985	endosome
GO:0030659	0.983	cytoplasmic vesicle membrane
GO:0005886	0.945	plasma membrane
GO:0010008	0.945	endosome membrane
GO:0070013	0.334	intracellular organelle lumen
GO:0042582	0.325	azurophil granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:37047	0.392	H(+)(out) + L-histidine(out) = H(+)(in) + L-histidine(in)

[back to server]