StarFunc result for job id Q8N6C5

User Input

>input (1336 residues)
MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
LELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYD
ASYRGSLLSDVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGED
KPLQFLDATSIDDNTSFFLNNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPK
PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIR
WKCRRLRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNF
PLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHC
HSWEEMAVSEPSEALELVGTDILPKPVISASPTIRGQELQLRCKGWLAGMGFALYKEGEQ
EPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPF
FKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVG
IGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRCQGTFQ
GMRFALLQEGAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPL
MIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSND
GAFPITNISGTSMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGPMVAPG
ENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDS
TPFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEE
APQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVG
NIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPANS
PSSTSQRISVELPVPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6C5	1.000	1.000	0.000	1336	1.000	1.000	Q8N6C5.pdb.gz	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
2	AFDB:Q925N6	0.445	0.450	0.000	1320	0.843	0.853	Q925N6.pdb.gz	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
3	AFDB:Q96RD9	0.098	0.125	5.687E-41	977	0.153	0.209	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
4	AFDB:A7LCJ3	0.121	0.105	7.427E-41	1730	0.174	0.135	A7LCJ3.pdb.gz	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
5	AFDB:F1NY98	0.090	0.067	1.561E-37	2034	0.141	0.093	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
6	AFDB:P97484	0.189	0.277	3.674E-36	841	0.132	0.210	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
7	AFDB:A0A0B4K6Z6	0.091	0.068	5.122E-34	2037	0.132	0.086	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
8	AFDB:Q8AV57	0.099	0.071	5.853E-34	2177	0.130	0.080	Q8AV57.pdb.gz	SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 GN=SDK2 PE=1 SV=2
9	AFDB:O75147	0.084	0.066	9.132E-34	1896	0.139	0.098	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
10	AFDB:B0V2N1	0.106	0.083	1.425E-33	1907	0.132	0.093	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
11	PDB:1e07A	0.093	0.167	4.295E-20	642	0.087	0.181	1e07A.pdb.gz
12	PDB:5a42A	0.101	0.089	1.593E-17	1597	0.097	0.081	5a42A.pdb.gz
13	PDB:5oj2B	0.119	0.191	4.431E-17	692	0.083	0.160	5oj2B.pdb.gz
14	PDB:7q1yA	0.095	0.093	3.064E-14	1374	0.059	0.057	7q1yA.pdb.gz
15	PDB:7q5zA	0.097	0.097	3.827E-14	1344	0.076	0.075	7q5zA.pdb.gz
16	PDB:4ziqA	0.105	0.099	2.097E-12	1450	0.091	0.083	4ziqA.pdb.gz
17	PDB:7vonA	0.100	0.097	5.579E-12	1399	0.077	0.074	7vonA.pdb.gz
18	PDB:6h03A	0.100	0.106	6.375E-12	1223	0.079	0.086	6h03A.pdb.gz
19	PDB:7sqcO0	0.093	0.099	1.137E-11	1140	0.082	0.096	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:4lnvA	0.095	0.098	2.316E-11	1276	0.064	0.067	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6C5	0.0	2758	1336	1.000	1.000	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
2	Q925N6	0.0	2360	1320	0.850	0.861	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
3	O75022	1.12e-49	189	631	0.108	0.228	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
4	Q8N149	1.49e-49	186	483	0.108	0.298	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	P04217	5.49e-49	184	495	0.120	0.323	A1BG_HUMAN Alpha-1B-glycoprotein OS=Homo sapiens OX=9606 GN=A1BG PE=1 SV=4
6	Q8K4V6	1.84e-48	187	697	0.132	0.254	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
7	P97484	9.76e-48	187	841	0.135	0.215	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
8	Q8N6C8	4.00e-44	169	439	0.099	0.301	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	P59901	1.60e-43	168	499	0.100	0.267	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
10	O75023	2.98e-43	169	590	0.112	0.253	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
11	O75019	1.30e-42	166	489	0.101	0.276	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
12	Q8N423	2.30e-41	164	597	0.102	0.228	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
13	Q8NHL6	1.91e-40	162	650	0.101	0.208	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
14	Q8IYS5	5.21e-35	137	282	0.061	0.287	OSCAR_HUMAN Osteoclast-associated immunoglobulin-like receptor OS=Homo sapiens OX=9606 GN=OSCAR PE=1 SV=3
15	Q8VBT3	7.34e-32	128	265	0.055	0.279	OSCAR_MOUSE Osteoclast-associated immunoglobulin-like receptor OS=Mus musculus OX=10090 GN=Oscar PE=2 SV=1
16	B6A8R8	1.33e-31	128	288	0.058	0.271	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
17	B6A8C7	3.65e-31	126	271	0.065	0.321	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
18	Q8N743	2.61e-30	127	410	0.076	0.246	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
19	Q28109	6.17e-30	122	264	0.061	0.307	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
20	Q14943	1.73e-26	115	382	0.076	0.267	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	5.3e-21	85.8	Immunoglobulin I-set domain
2	PF00047 ig	3.2e-37	137.9	Immunoglobulin domain
3	PF13895 Ig_2	4.5e-95	323.4	Immunoglobulin domain
4	PF13927 Ig_3	3.4e-56	199.1	Immunoglobulin domain
5	PF18452 Ig_6	53	15.1	Immunoglobulin domain
6	PF16706 Izumo-Ig	0.97	20.7	Izumo-like Immunoglobulin domain
7	PF05743 UEV	3.2	19.1	UEV domain
8	PF07686 V-set	4.7e-12	57.4	Immunoglobulin V-set domain
9	PF15910 V-set_2	32	16.1	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242208	0.871	Inhibin beta A chain
2	9606.ENSP00000298542	0.731	FERM domain-containing protein 7
3	9606.ENSP00000358482	0.707	Immunoglobulin superfamily member 2
4	9606.ENSP00000430711	0.687	Thyrotropin-releasing hormone receptor
5	9606.ENSP00000359382	0.665	Circadian clock protein PASD1
6	9606.ENSP00000256592	0.664	Thyrotropin subunit beta
7	9606.ENSP00000297596	0.642	GTP-binding protein GEM
8	9606.ENSP00000318374	0.642	Leukocyte receptor cluster member 8
9	9606.ENSP00000364265	0.624	Forkhead box protein E1
10	9606.ENSP00000303452	0.621	Pro-thyrotropin-releasing hormone
11	9606.ENSP00000442656	0.602	Activin receptor type-1B
12	9606.ENSP00000322784	0.556	Olfactory receptor 5AK2
13	9606.ENSP00000238875	0.547	Galectin-related protein
14	9606.ENSP00000427951	0.546	Coiled-coil domain containing 160
15	9606.ENSP00000276211	0.535	Rho GTPase-activating protein 36
16	9606.ENSP00000263334	0.519	Paired box protein Pax-8
17	9606.ENSP00000327758	0.515	Homeobox protein Nkx-2.5
18	9606.ENSP00000220616	0.514	Thyroglobulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0038023	0.998	signaling receptor activity
GO:0030545	0.997	signaling receptor regulator activity
GO:0015026	0.994	coreceptor activity
GO:0030547	0.986	signaling receptor inhibitor activity
GO:0048019	0.306	receptor antagonist activity
GO:0038102	0.301	activin receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0090092	0.951	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0080090	0.948	regulation of primary metabolic process
GO:0031326	0.948	regulation of cellular biosynthetic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0032925	0.931	regulation of activin receptor signaling pathway
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0006355	0.915	regulation of DNA-templated transcription
GO:0048519	0.914	negative regulation of biological process
GO:0048523	0.900	negative regulation of cellular process
GO:0090101	0.819	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009987	0.725	cellular process
GO:0048518	0.460	positive regulation of biological process
GO:0050896	0.459	response to stimulus
GO:0048856	0.437	anatomical structure development
GO:0032501	0.406	multicellular organismal process
GO:0051716	0.337	cellular response to stimulus
GO:0048522	0.332	positive regulation of cellular process
GO:0007165	0.328	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043226	0.923	organelle
GO:0005622	0.917	intracellular anatomical structure
GO:0043227	0.909	membrane-bounded organelle
GO:0071944	0.908	cell periphery
GO:0043229	0.859	intracellular organelle
GO:0043231	0.808	intracellular membrane-bounded organelle
GO:0005886	0.655	plasma membrane
GO:0005737	0.628	cytoplasm
GO:0070013	0.444	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]