StarFunc result for job id Q8N6C8

User Input

>input (439 residues)
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6C8	1.000	1.000	1.137E-88	439	1.000	1.000	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
2	AFDB:O75019	0.885	0.799	5.313E-80	489	0.852	0.765	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
3	AFDB:Q8N423	0.930	0.688	7.919E-74	598	0.795	0.584	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	AFDB:Q8NHL6	0.895	0.612	1.323E-73	650	0.838	0.566	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
5	AFDB:Q8N149	0.882	0.804	7.830E-68	483	0.809	0.735	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
6	AFDB:O75023	0.883	0.662	6.725E-60	590	0.608	0.453	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
7	AFDB:P59901	0.705	0.634	1.694E-59	499	0.658	0.579	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
8	AFDB:O75022	0.842	0.599	1.549E-57	631	0.647	0.450	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:P97484	0.781	0.425	2.645E-46	841	0.487	0.254	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:P43629	0.563	0.557	3.077E-31	444	0.292	0.288	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	PDB:5oj2B	0.187	0.129	1.399E-10	692	0.171	0.108	5oj2B.pdb.gz
12	PDB:7q1yA	0.181	0.075	1.717E-10	1374	0.125	0.040	7q1yA.pdb.gz
13	PDB:1e07A	0.189	0.140	5.045E-10	642	0.153	0.104	1e07A.pdb.gz
14	PDB:7vonA	0.180	0.079	1.147E-9	1399	0.128	0.040	7vonA.pdb.gz
15	PDB:7q5zA	0.196	0.081	4.383E-8	1344	0.112	0.036	7q5zA.pdb.gz
16	PDB:4ziqA	0.194	0.074	6.608E-8	1450	0.128	0.039	4ziqA.pdb.gz
17	PDB:5a42A	0.176	0.072	8.114E-8	1597	0.121	0.033	5a42A.pdb.gz
18	PDB:4rtdA	0.153	0.073	9.464E-8	1122	0.125	0.049	4rtdA.pdb.gz
19	PDB:1hzhH	0.191	0.186	1.049E-7	457	0.118	0.114	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:7nycA	0.149	0.059	1.664E-7	1542	0.144	0.041	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	746	489	0.852	0.765	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	553	631	0.656	0.456	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	P59901	0.0	543	499	0.661	0.581	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
4	Q8N149	0.0	698	483	0.813	0.739	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	Q8N423	0.0	681	597	0.790	0.581	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	Q8N6C8	0.0	895	439	1.000	1.000	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
7	Q8NHL6	0.0	723	650	0.825	0.557	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	O75023	9.42e-169	488	590	0.608	0.453	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	P97484	3.67e-130	397	841	0.494	0.258	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	9.26e-127	384	697	0.492	0.310	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	A6NI73	7.39e-77	243	299	0.301	0.441	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
12	Q8N743	5.97e-64	213	410	0.294	0.315	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	Q14943	1.02e-63	212	382	0.287	0.330	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
14	Q8NHJ6	1.13e-62	211	448	0.278	0.272	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
15	P43629	5.63e-61	206	444	0.287	0.284	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
16	P43630	1.44e-60	206	455	0.287	0.277	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
17	Q64281	2.47e-56	191	335	0.248	0.325	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	Q61450	2.08e-55	187	303	0.228	0.330	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
19	Q28109	1.17e-49	171	264	0.228	0.379	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
20	Q8N6C5	1.56e-44	168	1336	0.301	0.099	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	3e-12	57.9	Immunoglobulin domain
2	PF13895 Ig_2	1.1e-24	97.8	Immunoglobulin domain
3	PF13927 Ig_3	3.4e-21	86.9	Immunoglobulin domain
4	PF06328 Lep_receptor_Ig	1e+02	14.3	Ig-like C2-type domain
5	PF07686 V-set	41	15.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008953823.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008971906.1	0.910	Tyrosine-protein phosphatase non-receptor type 6 isoform X1
2	9597.XP_003824809.1	0.839	Fc fragment of IgG receptor IIb
3	9597.XP_003808402.1	0.834	Tyrosine-protein kinase SYK isoform X1
4	9597.XP_003804445.1	0.827	Low affinity immunoglobulin gamma Fc region receptor II-a isoform X1
5	9597.XP_008959144.1	0.826	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 69 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
6	9597.XP_003830216.1	0.825	Leukocyte immunoglobulin like receptor A5
7	9597.XP_003830207.1	0.818	Leukocyte immunoglobulin like receptor A4
8	9597.XP_008955201.1	0.736	Belongs to the MHC class I family.
9	9597.XP_008956333.1	0.720	Tyrosine-protein phosphatase non-receptor type 11
10	9597.XP_008962050.1	0.670	Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system
11	9597.XP_003816207.1	0.614	TYRO protein tyrosine kinase-binding protein isoform X1
12	9597.XP_008953345.1	0.614	Patr class I histocompatibility antigen, alpha chain G
13	9597.XP_003813392.1	0.577	CD300c molecule
14	9597.XP_003821032.1	0.562	Myeloid cell nuclear differentiation antigen
15	9597.XP_008953333.1	0.531	Patr class I histocompatibility antigen, CH28 alpha chain isoform X1
16	9597.XP_008964184.1	0.518	CMRF35-like molecule 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.938	transmembrane signaling receptor activity
GO:0005102	0.534	signaling receptor binding
GO:0003823	0.340	antigen binding
GO:0044877	0.311	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0007166	0.898	cell surface receptor signaling pathway
GO:0006950	0.884	response to stress
GO:0006952	0.869	defense response
GO:0048583	0.848	regulation of response to stimulus
GO:0002682	0.749	regulation of immune system process
GO:0050776	0.644	regulation of immune response
GO:0048518	0.617	positive regulation of biological process
GO:0051239	0.577	regulation of multicellular organismal process
GO:0002376	0.561	immune system process
GO:0048519	0.516	negative regulation of biological process
GO:0019222	0.406	regulation of metabolic process
GO:0002684	0.390	positive regulation of immune system process
GO:0006955	0.386	immune response
GO:0002764	0.348	immune response-regulating signaling pathway
GO:0048522	0.342	positive regulation of cellular process
GO:0060255	0.324	regulation of macromolecule metabolic process
GO:0048584	0.320	positive regulation of response to stimulus
GO:0048523	0.307	negative regulation of cellular process
GO:0032101	0.301	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.863	endomembrane system
GO:0005622	0.717	intracellular anatomical structure
GO:0005737	0.704	cytoplasm
GO:0031982	0.703	vesicle
GO:0031410	0.675	cytoplasmic vesicle
GO:0031090	0.503	organelle membrane
GO:0098588	0.460	bounding membrane of organelle
GO:0030659	0.421	cytoplasmic vesicle membrane
GO:0030141	0.377	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]